PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS10084587 to PF11523 (DUF3223)

VIMSS10084587 has 1453 amino acids

Query:       DUF3223  [M=75]
Accession:   PF11523.8
Description: Protein of unknown function (DUF3223)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence      Description
    ------- ------ -----    ------- ------ -----   ---- --  --------      -----------
    2.6e-26   78.6   0.2    8.2e-26   77.0   0.1    2.0  2  VIMSS10084587  


Domain annotation for each sequence (and alignments):
>> VIMSS10084587  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   -3.8   0.0         1         1      43      65 ..     714     733 ..     668     734 .. 0.70
   2 !   77.0   0.1   8.2e-26   8.2e-26       1      75 []    1347    1419 ..    1347    1419 .. 0.95

  Alignments for each domain:
  == domain 1  score: -3.8 bits;  conditional E-value: 1
                    EEE.EESSS.S-EEEEEEETTS- CS
        DUF3223  43 ikvglhpefedsrCFfvvrkDgs 65 
                    +  ++   + +s +F +++k gs
  VIMSS10084587 714 LAYRY---GDQSNSFLIMSKAGS 733
                    44444...345888888887776 PP

  == domain 2  score: 77.0 bits;  conditional E-value: 8.2e-26
                     HHHHHHS-TTEE--HHHHHHHHH.HHHTSTTHHHHHTT-EEEEEE.EESSS.S-EEEEEEETTS-EEE--GGGSS CS
        DUF3223    1 keiLhkydvgeelsdedeailleellkyhpeaekkigagvdsikvglhpefedsrCFfvvrkDgsaeDFSyrkCv 75  
                     k+iLh+y+ +e l+++de ++ + +l+ hp++ +kig gv++i+v++ ++++ds CF vvr Dg+ eDFSy+kCv
  VIMSS10084587 1347 KRILHSYEINELLNERDEGLVKM-VLQLHPNSVEKIGPGVKGIRVAK-SKHGDSCCFEVVRIDGTFEDFSYHKCV 1419
                     78****************96665.**********************9.7889**********************8 PP



Or compare VIMSS10084587 to CDD or PaperBLAST