PaperBLAST – Find papers about a protein or its homologs

 

Align XP_001019287.2 to PF11523 (DUF3223)

XP_001019287.2 has 340 amino acids

Query:       DUF3223  [M=75]
Accession:   PF11523.8
Description: Protein of unknown function (DUF3223)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
    4.4e-27   81.1   0.4    4.4e-27   81.1   0.4    2.5  3  XP_001019287.2  


Domain annotation for each sequence (and alignments):
>> XP_001019287.2  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   -2.9   0.0      0.75      0.75      12      32 ..      21      37 ..      16      50 .. 0.65
   2 ?   -1.7   0.3      0.31      0.31      14      31 ..     218     234 ..     205     243 .. 0.52
   3 !   81.1   0.4   4.4e-27   4.4e-27       1      75 []     259     331 ..     259     331 .. 0.95

  Alignments for each domain:
  == domain 1  score: -2.9 bits;  conditional E-value: 0.75
                    E--HHHHHHHHH.HHHTSTTH CS
         DUF3223 12 elsdedeailleellkyhpea 32
                     ++de++++    + + hpe 
  XP_001019287.2 21 LVNDEKFRT----IIQEHPEG 37
                    556666654....44477775 PP

  == domain 2  score: -1.7 bits;  conditional E-value: 0.31
                     -HHHHHHHHH.HHHTSTT CS
         DUF3223  14 sdedeailleellkyhpe 31 
                     ++++ +  ++ + k  +e
  XP_001019287.2 218 KKKEVNQTVK-AKKDKKE 234
                     3333333332.3333333 PP

  == domain 3  score: 81.1 bits;  conditional E-value: 4.4e-27
                     HHHHHHS-TTEE--HHHHHHHHH.HHHTSTTHHHHHTT-EEEEEE.EESSS.S-EEEEEEETTS-EEE--GGGSS CS
         DUF3223   1 keiLhkydvgeelsdedeailleellkyhpeaekkigagvdsikvglhpefedsrCFfvvrkDgsaeDFSyrkCv 75 
                     k iL ++++g+++  + +++ l++ll+yh+++e k++  +d+++v+ hpe++d+rCFfvv++Dg++eDFS +kC+
  XP_001019287.2 259 KGILGRTANGQKIISPYHEM-LKSLLEYHNNKEAKLK-DLDHFTVDVHPEHKDTRCFFVVKSDGTKEDFSAVKCI 331
                     5799************9996.556*************.************************************8 PP



Or compare XP_001019287.2 to CDD or PaperBLAST