PaperBLAST – Find papers about a protein or its homologs

 

Align XP_011087245.1 to PF11523 (DUF3223)

XP_011087245.1 has 221 amino acids

Query:       DUF3223  [M=75]
Accession:   PF11523.8
Description: Protein of unknown function (DUF3223)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
    8.1e-29   86.7   0.2    1.5e-28   85.8   0.2    1.5  1  XP_011087245.1  


Domain annotation for each sequence (and alignments):
>> XP_011087245.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   85.8   0.2   1.5e-28   1.5e-28       2      75 .]     111     183 ..     110     183 .. 0.98

  Alignments for each domain:
  == domain 1  score: 85.8 bits;  conditional E-value: 1.5e-28
                     HHHHHS-TTEE--HHHHHHHHH.HHHTSTTHHHHHTT-EEEEEE.EESSS.S-EEEEEEETTS-EEE--GGGSS CS
         DUF3223   2 eiLhkydvgeelsdedeailleellkyhpeaekkigagvdsikvglhpefedsrCFfvvrkDgsaeDFSyrkCv 75 
                     ++Lh+++ + +l+++++ +lle l k+h eae+kig+gv+s++v+ hp+f +srCFf++r+D+s++DFS+rkCv
  XP_011087245.1 111 KLLHAWPANLNLNKYEHIVLLELLKKGHLEAERKIGKGVKSFQVRFHPQF-KSRCFFLIREDESVDDFSFRKCV 183
                     69**********************************************96.**********************8 PP



Or compare XP_011087245.1 to CDD or PaperBLAST