PaperBLAST – Find papers about a protein or its homologs

 

Align XP_020394614.1 to PF11523 (DUF3223)

XP_020394614.1 has 1444 amino acids

Query:       DUF3223  [M=75]
Accession:   PF11523.8
Description: Protein of unknown function (DUF3223)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
    4.5e-25   74.7   0.0    1.2e-24   73.3   0.0    1.8  1  XP_020394614.1  


Domain annotation for each sequence (and alignments):
>> XP_020394614.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   73.3   0.0   1.2e-24   1.2e-24       2      75 .]    1350    1422 ..    1349    1422 .. 0.98

  Alignments for each domain:
  == domain 1  score: 73.3 bits;  conditional E-value: 1.2e-24
                      HHHHHS-TTEE--HHHHHHHHH.HHHTSTTHHHHHTT-EEEEEE.EESSS.S-EEEEEEETTS-EEE--GGGSS CS
         DUF3223    2 eiLhkydvgeelsdedeailleellkyhpeaekkigagvdsikvglhpefedsrCFfvvrkDgsaeDFSyrkCv 75  
                      ++L++y+ +  ++++d++ l+e +lk+h + ++kig+gv++ik+gl+p++ ++rCF ++r D+++eDFSy+kCv
  XP_020394614.1 1350 NMLREYPLNGYVAEPDKSQLIE-ALKFHSRGAEKIGVGVREIKIGLNPSHPGTRCFILLRNDDTTEDFSYHKCV 1422
                      8********************9.**************************************************8 PP



Or compare XP_020394614.1 to CDD or PaperBLAST