XP_020394614.1 has 1444 amino acids
Query: DUF3223 [M=75]
Accession: PF11523.12
Description: Protein of unknown function (DUF3223)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
3.4e-26 78.0 0.0 8.2e-26 76.7 0.0 1.7 1 XP_020394614.1
Domain annotation for each sequence (and alignments):
>> XP_020394614.1
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 76.7 0.0 8.2e-26 8.2e-26 2 75 .] 1350 1422 .. 1349 1422 .. 0.98
Alignments for each domain:
== domain 1 score: 76.7 bits; conditional E-value: 8.2e-26
DUF3223 2 aiLhryedgeelneedekvllekllkyHpeaekKigagikaitvdkhpdfkgsrCFfvvrkDGtkedFSyrkCv 75
++L++y+ + + e+d++ l+e +lk+H++ ++Kig g++ i+++ +p++ g+rCF+++r+D+t+edFSy+kCv
XP_020394614.1 1350 NMLREYPLNGYVAEPDKSQLIE-ALKFHSRGAEKIGVGVREIKIGLNPSHPGTRCFILLRNDDTTEDFSYHKCV 1422
79*******************9.**************************************************8 PP
Or compare XP_020394614.1 to CDD or PaperBLAST