PaperBLAST – Find papers about a protein or its homologs

 

Align SwissProt::A0A142I738 to PF11807 (UstYa)

SwissProt::A0A142I738 has 234 amino acids

Query:       UstYa  [M=220]
Accession:   PF11807.12
Description: Mycotoxin biosynthesis protein UstYa
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence              Description
    ------- ------ -----    ------- ------ -----   ---- --  --------              -----------
    4.3e-19   55.3   2.0    3.5e-16   45.8   0.8    2.5  2  SwissProt::A0A142I738  


Domain annotation for each sequence (and alignments):
>> SwissProt::A0A142I738  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !    9.4   0.0   4.7e-05   4.7e-05       3      89 ..      41     149 ..      38     150 .. 0.67
   2 !   45.8   0.8   3.5e-16   3.5e-16     163     219 ..     149     205 ..     148     206 .. 0.77

  Alignments for each domain:
  == domain 1  score: 9.4 bits;  conditional E-value: 4.7e-05
                  UstYa   3 psrrrslwsrllllvillllllllllllsvllssseksard....................kkqvsspspaldaieyekkefk..las 68 
                            +++rr  ++++ll+  +++l++++l+l + l + +  s  +                    +k   sp   +d +e+ ++++      
  SwissProt::A0A142I738  41 RQHRRLVLVNRLLAASTVALVMVSLWLGWELHTAKFGSMGSfpygfkyeleaakkvikleeYKFLGSPIFLDDGTELVPEPTPgpMKT 128
                            4555556666677888888888888888888777777777788666666666666666666666666666666666666666585555 PP

                  UstYa  69 deepsiyrgepspevdaaWed 89 
                                ++y geps+e+d +W++
  SwissProt::A0A142I738 129 LGVTDMYVGEPSKELDWNWNQ 149
                            556677*************76 PP

  == domain 2  score: 45.8 bits;  conditional E-value: 3.5e-16
                  UstYa 163 rlHldHCidyLrqsimChaDvtlltfnwvdgtdgpvpdfntehqCrdfdalldWake 219
                            +lH+dHC++ Lrq i+C++D+t+++     g ++++      h+Cr++d ++++  +
  SwissProt::A0A142I738 149 QLHWDHCLNHLRQMILCQGDLTPIPSKYYRGITDNYIFGDMPHTCRNWDSVREFITD 205
                            68**********************6665554233333223589*********99765 PP



Or compare SwissProt::A0A142I738 to CDD or PaperBLAST