NP_001258765.1 has 630 amino acids
Query: CUPID [M=136] Accession: PF11819.12 Description: Cytohesin Ubiquitin Protein Inducing Domain Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.3e-49 153.1 2.0 5e-49 152.0 2.0 1.6 1 NP_001258765.1 Domain annotation for each sequence (and alignments): >> NP_001258765.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 152.0 2.0 5e-49 5e-49 1 135 [. 2 140 .. 2 141 .. 0.98 Alignments for each domain: == domain 1 score: 152.0 bits; conditional E-value: 5e-49 CUPID 1 eskgelissssgsllssgsdesessekdkkeklralkkkqkaLqekLelkleELkklClrEAeLtGklpkeypLepgekppqvrRrigaafklde 95 e+kg+liss+++++++++ e++++ k +e+lr l+++q++Lqe+L+lkl+EL+k+Cl+EAeLtG+lp e+pLepge+p+ vrRr+ +a +++ NP_001258765.1 2 EVKGQLISSPTFNAPAALFGEAAPQVK--SERLRGLLDRQRTLQEALSLKLQELRKVCLQEAELTGQLPPECPLEPGERPQLVRRRPPTARAYPP 94 79*************************..9***************************************************************** PP CUPID 96 ekilqk......eedpeLesLerelalqqqiveAarrLaeeenlsk 135 + +q+ +e+ +Le+Lere+++qqqi++AarrLa +++ls+ NP_001258765.1 95 PHPNQAhhslcpAEELALEALEREVSVQQQIAAAARRLALAPDLST 140 9999989999999*******************************97 PP
Or compare NP_001258765.1 to CDD or PaperBLAST