PaperBLAST – Find papers about a protein or its homologs

 

Align NP_001258765.1 to PF11819 (DUF3338)

NP_001258765.1 has 630 amino acids

Query:       DUF3338  [M=136]
Accession:   PF11819.8
Description: Domain of unknown function (DUF3338)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
    4.4e-49  152.2   1.7    9.2e-49  151.1   1.7    1.6  1  NP_001258765.1  


Domain annotation for each sequence (and alignments):
>> NP_001258765.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  151.1   1.7   9.2e-49   9.2e-49       1     135 [.       2     140 ..       2     141 .. 0.97

  Alignments for each domain:
  == domain 1  score: 151.1 bits;  conditional E-value: 9.2e-49
         DUF3338   1 eskgelissssgsllssgskssessekqkkekvaalkkkqkaleerLelkleelkklClrEAeltGklpkeyPLkpgekppqvrRrvgtafklde 95 
                     e+kg+liss+++++++++  +++++ k  +e+++ l ++q++l+e+L+lkl+el+k+Cl+EAeltG+lp+e+PL+pge+p+ vrRr+ ta  ++ 
  NP_001258765.1   2 EVKGQLISSPTFNAPAALFGEAAPQVK--SERLRGLLDRQRTLQEALSLKLQELRKVCLQEAELTGQLPPECPLEPGERPQLVRRRPPTARAYPP 94 
                     79*************************..89**************************************************************** PP

         DUF3338  96 klllqk......aedpeLesLerelalqqqiaeAarrLaleenlsk 135
                      + +q+      ae+ +Le+Lere+++qqqia+AarrLal+++ls+
  NP_001258765.1  95 PHPNQAhhslcpAEELALEALEREVSVQQQIAAAARRLALAPDLST 140
                     *999997777766*******************************97 PP



Or compare NP_001258765.1 to CDD or PaperBLAST