PaperBLAST – Find papers about a protein or its homologs

 

Align NP_055938.1 to PF11819 (DUF3338)

NP_055938.1 has 1034 amino acids

Query:       DUF3338  [M=136]
Accession:   PF11819.8
Description: Domain of unknown function (DUF3338)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    2.9e-58  181.9   7.8    2.9e-58  181.9   7.8    2.1  2  NP_055938.1  


Domain annotation for each sequence (and alignments):
>> NP_055938.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  181.9   7.8   2.9e-58   2.9e-58       1     136 []     395     529 ..     395     529 .. 0.98
   2 ?   -3.4   0.1      0.49      0.49       3      22 ..     768     787 ..     767     790 .. 0.82

  Alignments for each domain:
  == domain 1  score: 181.9 bits;  conditional E-value: 2.9e-58
      DUF3338   1 eskgelissssgsllssgskssessekqkkekvaalkkkqkaleerLelkleelkklClrEAeltGklpkeyPLkpgekppqvrRrvgtafkldekll 98 
                  e+k ++i++s+gsl+ssgs++se+se+qk+ek+ +lkkk+k l+e+L +k+eelkk+ClrEAeltGk+pkeyPL+ gekppqvrRrvgtafkld++ l
  NP_055938.1 395 EAKSQFIMASNGSLISSGSQDSEVSEEQKREKILELKKKEKLLQEKLLKKVEELKKICLREAELTGKMPKEYPLNIGEKPPQVRRRVGTAFKLDDN-L 491
                  789********************************************************************************************7.6 PP

      DUF3338  99 lqkaedpeLesLerelalqqqiaeAarrLaleenlskk 136
                  l+++edp+L++Le+++ +qq+++eAa++La+e++l+k+
  NP_055938.1 492 LPSEEDPALQELESNFLIQQKLVEAAKKLANEPDLCKT 529
                  6678********************************95 PP

  == domain 2  score: -3.4 bits;  conditional E-value: 0.49
      DUF3338   3 kgelissssgsllssgskss 22 
                  k+++++s+sgs+++  +k+s
  NP_055938.1 768 KQNVSTSNSGSMPNLAQKDS 787
                  7899999****998777775 PP



Or compare NP_055938.1 to CDD or PaperBLAST