PaperBLAST – Find papers about a protein or its homologs

 

Align NP_060497.3 to PF11819 (DUF3338)

NP_060497.3 has 1039 amino acids

Query:       DUF3338  [M=136]
Accession:   PF11819.8
Description: Domain of unknown function (DUF3338)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    1.5e-63  199.0   5.3    1.5e-63  199.0   5.3    2.2  2  NP_060497.3  


Domain annotation for each sequence (and alignments):
>> NP_060497.3  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  199.0   5.3   1.5e-63   1.5e-63       2     136 .]     357     491 ..     356     491 .. 0.99
   2 ?   -1.9   0.6      0.18      0.18       7      36 ..     951     980 ..     946     990 .. 0.71

  Alignments for each domain:
  == domain 1  score: 199.0 bits;  conditional E-value: 1.5e-63
      DUF3338   2 skgelissssgsllssgskssessekqkkekvaalkkkqkaleerLelkleelkklClrEAeltGklpkeyPLkpgekppqvrRrvgtafkldeklll 99 
                  skg++is ssgsllssgs++s+ss+++kk+++aalk++q+alee+L+++leelkklClrEAeltGklp eyPL+pge+pp vrRr+gtafklde+++l
  NP_060497.3 357 SKGKIISGSSGSLLSSGSQESDSSQSAKKDMLAALKSRQEALEETLRQRLEELKKLCLREAELTGKLPVEYPLDPGEEPPIVRRRIGTAFKLDEQKIL 454
                  89************************************************************************************************ PP

      DUF3338 100 qkaedpeLesLerelalqqqiaeAarrLaleenlskk 136
                  +k e++eLe+Lere+a+q+qi+eAarrLa+++n+skk
  NP_060497.3 455 PKGEEAELERLEREFAIQSQITEAARRLASDPNVSKK 491
                  ***********************************96 PP

  == domain 2  score: -1.9 bits;  conditional E-value: 0.18
      DUF3338   7 issssgsllssgskssessekqkkekvaal 36 
                   ss+sgs  s+ s+s+ + ++ ++ + +  
  NP_060497.3 951 TSSDSGSQYSTSSQSTFVAHSRVTRMPQMC 980
                  578999999999999888877665554444 PP



Or compare NP_060497.3 to CDD or PaperBLAST