Q9Y2L6 has 1034 amino acids
Query: CUPID [M=136] Accession: PF11819.12 Description: Cytohesin Ubiquitin Protein Inducing Domain Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7.5e-61 190.3 8.2 2.1e-60 188.9 8.2 1.8 1 Q9Y2L6 Domain annotation for each sequence (and alignments): >> Q9Y2L6 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 188.9 8.2 2.1e-60 2.1e-60 1 136 [] 395 529 .. 395 529 .. 0.98 Alignments for each domain: == domain 1 score: 188.9 bits; conditional E-value: 2.1e-60 CUPID 1 eskgelissssgsllssgsdesessekdkkeklralkkkqkaLqekLelkleELkklClrEAeLtGklpkeypLepgekppqvrRrigaafkldeekilqkee 103 e+k+++i++s+gsl+ssgs++se+se++k+ek+ +lkkk+k LqekL +k+eELkk+ClrEAeLtGk+pkeypL+ gekppqvrRr+g+afkld+ ++l++ee Q9Y2L6 395 ETKSQFIMASNGSLISSGSQDSEVSEEQKREKILELKKKEKLLQEKLLKKVEELKKICLREAELTGKMPKEYPLNIGEKPPQVRRRVGTAFKLDD-NLLPSEE 496 6799*******************************************************************************************.58999** PP CUPID 104 dpeLesLerelalqqqiveAarrLaeeenlske 136 dp+L++Le+++ +qq++veAa++La+e++l+k+ Q9Y2L6 497 DPALQELESNFLIQQKLVEAAKKLANEPDLCKT 529 *******************************95 PP
Or compare Q9Y2L6 to CDD or PaperBLAST