PaperBLAST – Find papers about a protein or its homologs

 

Align SwissProt::A2AEV7 to PF11819 (DUF3338)

SwissProt::A2AEV7 has 629 amino acids

Query:       DUF3338  [M=136]
Accession:   PF11819.8
Description: Domain of unknown function (DUF3338)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence          Description
    ------- ------ -----    ------- ------ -----   ---- --  --------          -----------
      1e-46  144.5   0.5      2e-46  143.6   0.5    1.5  1  SwissProt::A2AEV7  


Domain annotation for each sequence (and alignments):
>> SwissProt::A2AEV7  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  143.6   0.5     2e-46     2e-46       1     134 [.       2     139 ..       2     141 .. 0.96

  Alignments for each domain:
  == domain 1  score: 143.6 bits;  conditional E-value: 2e-46
            DUF3338   1 eskgelissssgsllssgskssessekqkkekvaalkkkqkaleerLelkleelkklClrEAeltGklpkeyPLkpgekppqvrRrvgtafk 92 
                        e+kg+liss+++ +++++  ++++  k  +++++ l ++q+al+e+L+ kl+el+k+Cl+EAeltG+lp+e+PL+pge+p+ vrRr+ +a  
  SwissProt::A2AEV7   2 EVKGQLISSPTFTAPAALFGEAAPLVK--SDRLRGLLDRQRALQEALSVKLQELRKVCLQEAELTGQLPPECPLEPGERPQLVRRRPPAARA 91 
                        79*************************..88************************************************************* PP

            DUF3338  93 ldeklllqk......aedpeLesLerelalqqqiaeAarrLaleenls 134
                        ++  + +++      ae+ +Le+Lere+++qqqia+AarrLal+++l 
  SwissProt::A2AEV7  92 YPPPHPNPAhhslcpAEELALEALEREVSVQQQIAAAARRLALAPDLN 139
                        ***9999997777667*****************************985 PP



Or compare SwissProt::A2AEV7 to CDD or PaperBLAST