SwissProt::A2AEV7 has 629 amino acids
Query: CUPID [M=136] Accession: PF11819.12 Description: Cytohesin Ubiquitin Protein Inducing Domain Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.8e-47 147.0 0.6 3.6e-47 146.0 0.6 1.5 1 SwissProt::A2AEV7 Domain annotation for each sequence (and alignments): >> SwissProt::A2AEV7 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 146.0 0.6 3.6e-47 3.6e-47 1 134 [. 2 139 .. 2 141 .. 0.97 Alignments for each domain: == domain 1 score: 146.0 bits; conditional E-value: 3.6e-47 CUPID 1 eskgelissssgsllssgsdesessekdkkeklralkkkqkaLqekLelkleELkklClrEAeLtGklpkeypLepgekppqvrRrigaafk 92 e+kg+liss+++ +++++ e+++ k +++lr l+++q+aLqe+L+ kl+EL+k+Cl+EAeLtG+lp e+pLepge+p+ vrRr+ aa + SwissProt::A2AEV7 2 EVKGQLISSPTFTAPAALFGEAAPLVK--SDRLRGLLDRQRALQEALSVKLQELRKVCLQEAELTGQLPPECPLEPGERPQLVRRRPPAARA 91 79*************************..9************************************************************** PP CUPID 93 ldeekilqk......eedpeLesLerelalqqqiveAarrLaeeenls 134 ++ + +++ +e+ +Le+Lere+++qqqi++AarrLa +++l SwissProt::A2AEV7 92 YPPPHPNPAhhslcpAEELALEALEREVSVQQQIAAAARRLALAPDLN 139 **99988888899999*****************************985 PP
Or compare SwissProt::A2AEV7 to CDD or PaperBLAST