PaperBLAST – Find papers about a protein or its homologs

 

Align SwissProt::Q7TN12 to PF11819 (DUF3338)

SwissProt::Q7TN12 has 663 amino acids

Query:       DUF3338  [M=136]
Accession:   PF11819.8
Description: Domain of unknown function (DUF3338)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence          Description
    ------- ------ -----    ------- ------ -----   ---- --  --------          -----------
    2.4e-58  182.2   4.2    4.3e-58  181.4   4.2    1.4  1  SwissProt::Q7TN12  


Domain annotation for each sequence (and alignments):
>> SwissProt::Q7TN12  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  181.4   4.2   4.3e-58   4.3e-58       1     136 []      87     216 ..      87     216 .. 0.97

  Alignments for each domain:
  == domain 1  score: 181.4 bits;  conditional E-value: 4.3e-58
            DUF3338   1 eskgelissssgsllssgskssessekqkkekvaalkkkqkaleerLelkleelkklClrEAeltGklpkeyPLkpgekppqvrRrvgtafk 92 
                        esk+e+++s+sg++l+sg++s+ s++k++   ++a++k+q+ale+rLe++leel++lClrEAeltG+lp+eyPLkpgek+p+vrRr+g+a+k
  SwissProt::Q7TN12  87 ESKDEVSDSDSGIILQSGPDSPVSPMKEL---TNAVRKQQRALEARLEACLEELRRLCLREAELTGTLPAEYPLKPGEKAPKVRRRIGAAYK 175
                        79*************************88...************************************************************ PP

            DUF3338  93 ldeklllqkaedpeLesLerelalqqqiaeAarrLaleenlskk 136
                        lde +l++  edp L+sLer+lalq qi+eAarrL+ eenls++
  SwissProt::Q7TN12 176 LDEWALHR--EDP-LSSLERQLALQLQITEAARRLCAEENLSRQ 216
                        ***87766..799.****************************86 PP



Or compare SwissProt::Q7TN12 to CDD or PaperBLAST