PaperBLAST – Find papers about a protein or its homologs

 

Align SwissProt::Q8BIE6 to PF11819 (DUF3338)

SwissProt::Q8BIE6 has 1020 amino acids

Query:       DUF3338  [M=136]
Accession:   PF11819.8
Description: Domain of unknown function (DUF3338)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence          Description
    ------- ------ -----    ------- ------ -----   ---- --  --------          -----------
    1.7e-63  198.9   5.2    1.7e-63  198.9   5.2    2.3  2  SwissProt::Q8BIE6  


Domain annotation for each sequence (and alignments):
>> SwissProt::Q8BIE6  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  198.9   5.2   1.7e-63   1.7e-63       2     136 .]     342     476 ..     341     476 .. 0.99
   2 ?   -1.7   0.5      0.15      0.15       7      35 ..     932     960 ..     926     971 .. 0.70

  Alignments for each domain:
  == domain 1  score: 198.9 bits;  conditional E-value: 1.7e-63
            DUF3338   2 skgelissssgsllssgskssessekqkkekvaalkkkqkaleerLelkleelkklClrEAeltGklpkeyPLkpgekppqvrRrvgtafkl 93 
                        skg++is ssgsllssgs++s+ss+++kk+++aalk++q+alee+L+++leelk+lClrEAeltGklp eyPL+pge+pp vrRr+gtafkl
  SwissProt::Q8BIE6 342 SKGKIISGSSGSLLSSGSQESDSSQSAKKDMLAALKSRQEALEETLRQRLEELKRLCLREAELTGKLPVEYPLDPGEEPPIVRRRIGTAFKL 433
                        89****************************************************************************************** PP

            DUF3338  94 deklllqkaedpeLesLerelalqqqiaeAarrLaleenlskk 136
                        de+++l+k e++eLe+Lere+a+q+qi+eAarrLa+++n+skk
  SwissProt::Q8BIE6 434 DEQKILPKGEEAELERLEREFAIQSQITEAARRLASDPNVSKK 476
                        *****************************************96 PP

  == domain 2  score: -1.7 bits;  conditional E-value: 0.15
            DUF3338   7 issssgsllssgskssessekqkkekvaa 35 
                         ss+sgs  s+ s+s+ + ++ ++ + + 
  SwissProt::Q8BIE6 932 TSSDSGSQYSTSSQSTFVAHSRVTRMPQM 960
                        57899999999999888877766555444 PP



Or compare SwissProt::Q8BIE6 to CDD or PaperBLAST