PaperBLAST – Find papers about a protein or its homologs

 

Align SwissProt::Q920B0 to PF11819 (DUF3338)

SwissProt::Q920B0 has 1035 amino acids

Query:       DUF3338  [M=136]
Accession:   PF11819.8
Description: Domain of unknown function (DUF3338)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence          Description
    ------- ------ -----    ------- ------ -----   ---- --  --------          -----------
      4e-57  178.2   6.9    1.2e-56  176.7   6.9    1.9  1  SwissProt::Q920B0  


Domain annotation for each sequence (and alignments):
>> SwissProt::Q920B0  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  176.7   6.9   1.2e-56   1.2e-56       1     136 []     395     529 ..     395     529 .. 0.97

  Alignments for each domain:
  == domain 1  score: 176.7 bits;  conditional E-value: 1.2e-56
            DUF3338   1 eskgelissssgsllssgskssessekqkkekvaalkkkqkaleerLelkleelkklClrEAeltGklpkeyPLkpgekppqvrRrvgtafk 92 
                        e+k ++i++s+gsl+ssgs++se  e+qk+ek+ +lkkk+k l+e+L +k+eelkk+ClrEAeltG++pkeyPL+ gekppqvrRrvgt+fk
  SwissProt::Q920B0 395 EAKSQFIMASNGSLISSGSQDSEGMEEQKREKILELKKKEKLLQEKLLQKVEELKKICLREAELTGRMPKEYPLNIGEKPPQVRRRVGTTFK 486
                        789***************************************************************************************** PP

            DUF3338  93 ldeklllqkaedpeLesLerelalqqqiaeAarrLaleenlskk 136
                        ld++ ll+++edp+L++Le+++ +qq+++eAa++La+e++l+k+
  SwissProt::Q920B0 487 LDDN-LLPTEEDPALQELESNFLIQQKLVEAAKKLASEPDLCKT 529
                        ***7.66668********************************95 PP



Or compare SwissProt::Q920B0 to CDD or PaperBLAST