PaperBLAST – Find papers about a protein or its homologs

 

Align CharProtDB::CH_090986 to PF11879 (DUF3399)

CharProtDB::CH_090986 has 490 amino acids

Query:       DUF3399  [M=104]
Accession:   PF11879.8
Description: Domain of unknown function (DUF3399)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence              Description
    ------- ------ -----    ------- ------ -----   ---- --  --------              -----------
    6.4e-13   35.3   0.2    1.7e-12   33.9   0.2    1.7  1  CharProtDB::CH_090986  


Domain annotation for each sequence (and alignments):
>> CharProtDB::CH_090986  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   33.9   0.2   1.7e-12   1.7e-12      13      47 ..     455     489 ..     445     490 .] 0.70

  Alignments for each domain:
  == domain 1  score: 33.9 bits;  conditional E-value: 1.7e-12
                DUF3399  13 lelteseeeealvtkstsllEsqHHHLLhCLEKtt 47 
                            +  +es  e     + ++++E qHHHLL+CLEKtt
  CharProtDB::CH_090986 455 WAAQESGIELDDNYRDEDIFELQHHHLLRCLEKTT 489
                            44444444455567889*****************9 PP



Or compare CharProtDB::CH_090986 to CDD or PaperBLAST