PaperBLAST – Find papers about a protein or its homologs

 

Align SwissProt::Q9RP48 to PF11896 (DUF3416)

SwissProt::Q9RP48 has 697 amino acids

Query:       DUF3416  [M=179]
Accession:   PF11896.8
Description: Domain of unknown function (DUF3416)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence          Description
    ------- ------ -----    ------- ------ -----   ---- --  --------          -----------
    6.8e-62  195.1   0.0      1e-61  194.5   0.0    1.3  1  SwissProt::Q9RP48  


Domain annotation for each sequence (and alignments):
>> SwissProt::Q9RP48  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  194.5   0.0     1e-61     1e-61       1     179 []       8     222 ..       8     222 .. 0.92

  Alignments for each domain:
  == domain 1  score: 194.5 bits;  conditional E-value: 1e-61
            DUF3416   1 griaIedvsPevdgGrfpaKavvGetvpVeAdvfrdGhdalaAtlvlr............................ragekewqevpMt.pg 63 
                        gri I+dv+P+v++Gr+paKavvGe+vpV+A+v+r+Ghda++Atlv+r                              ++ + q ++M+   
  SwissProt::Q9RP48   8 GRIGIDDVAPVVSCGRYPAKAVVGEVVPVRATVWREGHDAVSATLVVRylgtefprlasgpgttppavplgtvvqpG-KRVKPQILQMSkGR 98 
                        69**********************************************99999999999999999999888888642.34788899***855 PP

            DUF3416  64 gndrweasftpdelGryeftveAWvDpfatWrhdlekkveagqdvele...leeGarlleraaeraea....aalraaaaalrdd..peerl 146
                         +d+++++ftpd++G ++f+v++W Dp+atWrh++e+k+eagq+ ++    l+ Garll raae        ++l +aa++lr++  p +r+
  SwissProt::Q9RP48  99 TPDVFHGEFTPDAVGLWTFRVDGWGDPIATWRHAVEAKLEAGQSETELnndLLVGARLLMRAAEGV-PrklrDPLLEAAQQLRTPgdPYQRA 189
                        69****************************************987766677************665.2599999********88888***** PP

            DUF3416 147 aaalseevaallaryplrelatrseklpveVdR 179
                          als+eva+ll +yplre++tr+e + v+VdR
  SwissProt::Q9RP48 190 GGALSPEVADLLLQYPLREFVTRGEVHGVWVDR 222
                        ********************************9 PP



Or compare SwissProt::Q9RP48 to CDD or PaperBLAST