PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS1768991 to PF11896 (DUF3416)

VIMSS1768991 has 646 amino acids

Query:       DUF3416  [M=179]
Accession:   PF11896.8
Description: Domain of unknown function (DUF3416)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence     Description
    ------- ------ -----    ------- ------ -----   ---- --  --------     -----------
    9.6e-68  214.1   0.5    1.4e-67  213.6   0.5    1.3  1  VIMSS1768991  


Domain annotation for each sequence (and alignments):
>> VIMSS1768991  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  213.6   0.5   1.4e-67   1.4e-67       3     179 .]       8     186 ..       6     186 .. 0.98

  Alignments for each domain:
  == domain 1  score: 213.6 bits;  conditional E-value: 1.4e-67
       DUF3416   3 iaIedvsPevdgGrfpaKavvGetvpVeAdvfrdGhdalaAtlvlrragekewqevpMtpggndrweasftpdelGryeftveAWvDpfatWrhdle 99 
                   i Iedv Pe+d+Gr+p+K+ vG++++V+Ad+f+dGhda++A + +r++g+++w+evpM++++ndrw+asf+++++ ry++t+eAW D+f+tWr+++ 
  VIMSS1768991   8 IIIEDVYPELDCGRYPIKREVGDRLEVWADIFKDGHDAVSAVVRYRERGARRWSEVPMRHHENDRWTASFPLTRNTRYQYTIEAWPDEFETWRSEVG 104
                   89*********************************************************999*********************************** PP

       DUF3416 100 kkveagqdveleleeGarlleraaeraeaaalraaaaalrdd.peerlaaalseevaallaryplrelatrsek.lpveVdR 179
                   kk+eagq+ve+el+eG+++lera +r++  +lr+ ++a++++  e rla++ seev+ l++++p+r+lat + k l+v VdR
  VIMSS1768991 105 KKLEAGQRVEVELLEGREILERAYSRSKDGRLRQTLDAFDAAgYEGRLALLRSEEVRGLMREHPDRSLATAYGKtLEVVVDR 186
                   **************************97799********666799************************************9 PP



Or compare VIMSS1768991 to CDD or PaperBLAST