PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS2041545 to PF11896 (DUF3416)

VIMSS2041545 has 1138 amino acids

Query:       DUF3416  [M=179]
Accession:   PF11896.8
Description: Domain of unknown function (DUF3416)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence     Description
    ------- ------ -----    ------- ------ -----   ---- --  --------     -----------
    2.9e-60  189.8   3.1    4.8e-60  189.1   3.1    1.4  1  VIMSS2041545  


Domain annotation for each sequence (and alignments):
>> VIMSS2041545  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  189.1   3.1   4.8e-60   4.8e-60       2     179 .]     448     650 ..     447     650 .. 0.92

  Alignments for each domain:
  == domain 1  score: 189.1 bits;  conditional E-value: 4.8e-60
       DUF3416   2 riaIedvsPevdgGrfpaKavvGetvpVeAdvfrdGhdalaAtlvlrragekewqevpMtpggndrweasftpdelGryeftveAWvDpfatWrhdl 98 
                   riaIe+v+P++++Grf++++vvGe+v+V+Ad+++dGhd+laA++++r+ ge+ w+++pM+p+ ndrwe+sf++ +lGr+eftveAW+D+fa+W +++
  VIMSS2041545 448 RIAIEHVEPACNEGRFAVRRVVGERVTVSADIWMDGHDKLAAMVLWRAPGETGWHQAPMQPVINDRWEGSFPLVALGRHEFTVEAWRDTFASWLDEI 544
                   9************************************************************************************************ PP

       DUF3416  99 ekkveagqdveleleeGarlleraaeraea.................aalraaaaal...rddpeerlaaalseeva....allaryplrelatrse 171
                    kk +ag +v+le+eeGarl+++a+ + ++                  +l+a++++l   + d+++r +++ls++++    a++a+ + r++a+r++
  VIMSS2041545 545 GKKRAAGLNVALEIEEGARLVADALLQPARngkqgnggkntrtatadTELSAIVDELitaAGDDARRQEILLSPRTEaamqAVMATPAGRPFASRHP 641
                   ************************97775589999999998888877779999999987645588888888888877444467778889******** PP

       DUF3416 172 k.lpveVdR 179
                     +pve+dR
  VIMSS2041545 642 VaMPVEADR 650
                   ********9 PP



Or compare VIMSS2041545 to CDD or PaperBLAST