PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS2165871 to PF11896 (DUF3416)

VIMSS2165871 has 1038 amino acids

Query:       DUF3416  [M=179]
Accession:   PF11896.8
Description: Domain of unknown function (DUF3416)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence     Description
    ------- ------ -----    ------- ------ -----   ---- --  --------     -----------
    1.1e-54  171.6   3.3    1.1e-54  171.6   3.3    2.1  2  VIMSS2165871  


Domain annotation for each sequence (and alignments):
>> VIMSS2165871  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   -4.0   0.1      0.85      0.85     118     138 ..      45      66 ..      36      79 .. 0.56
   2 !  171.6   3.3   1.1e-54   1.1e-54       2     179 .]     388     571 ..     387     571 .. 0.96

  Alignments for each domain:
  == domain 1  score: -4.0 bits;  conditional E-value: 0.85
       DUF3416 118 lleraaeraea.aalraaaaal 138
                   l+e aa  +++ ++l++a++a 
  VIMSS2165871  45 LIEPAAGAQTQaQRLQEAVQAA 66 
                   4444443332245555555554 PP

  == domain 2  score: 171.6 bits;  conditional E-value: 1.1e-54
       DUF3416   2 riaIedvsPevdgGrfpaKavvGetvpVeAdvfrdGhdalaAtlvlrragekewqevpMtpggndrweasftpdelGryeftveAWvDpfatWrhdl 98 
                   r+ Ie+v+P+vd+Grfp+K++vG+++ VeAd f+dGhd++a+++++r a++k+w ++pM+++gndrw+a+f+++++G+yef+veAW+D fat + dl
  VIMSS2165871 388 RVCIESVTPSVDNGRFPVKRTVGDRICVEADAFCDGHDRIAVAVLWRPADAKAWASAPMRALGNDRWRAEFPLERIGTYEFRVEAWRDVFATLHADL 484
                   9************************************************************************************************ PP

       DUF3416  99 ekkveagqdveleleeGarlleraaeraea...aalraaaaal..rddpeerlaaalseevaallaryplrelatrsek.lpveVdR 179
                   ekk +a+  + ++++e+ + +++a +r++    ++l+++++++  +++p ++la++l++++a+++a ++++++ ++++  ++ve +R
  VIMSS2165871 485 EKKRAANTVLPVDVQEAVAAVQAAQARSDGalaERLQTVLTRIgaQSEPLQQLAIVLEPDTAQAMALADDKPFRSEYPVtFRVESER 571
                   *************************99977999999999999965445*****************************9999998887 PP



Or compare VIMSS2165871 to CDD or PaperBLAST