PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS2197508 to PF11896 (DUF3416)

VIMSS2197508 has 664 amino acids

Query:       DUF3416  [M=179]
Accession:   PF11896.8
Description: Domain of unknown function (DUF3416)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence     Description
    ------- ------ -----    ------- ------ -----   ---- --  --------     -----------
    1.7e-50  157.9   0.1    2.9e-50  157.2   0.1    1.4  1  VIMSS2197508  


Domain annotation for each sequence (and alignments):
>> VIMSS2197508  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  157.2   0.1   2.9e-50   2.9e-50       2     179 .]      21     203 ..      20     203 .. 0.94

  Alignments for each domain:
  == domain 1  score: 157.2 bits;  conditional E-value: 2.9e-50
       DUF3416   2 riaIedvsPevdgGrfpaKavvGetvpVeAdvfrdGhdalaAtlvlrragekewqevpMtpggndrweasftpdelGryeftveAWvDpfatWrhdl 98 
                   riaIe+vsP+v++G++paK   + +++  A +f+dGh+ l+A++v+rr ge++++++p+ p+gnd w+a+++    Gr  f++eAW+D+fa +r++l
  VIMSS2197508  21 RIAIESVSPVVEEGAYPAKTESDRDLRLAARIFTDGHEVLGAEVVWRRVGETAERRLPLLPEGNDFWSAQLRTPPCGRLYFRIEAWIDRFAGYRREL 117
                   9************************************************************************************************ PP

       DUF3416  99 ekkveagqdveleleeGarlleraaeraea...aalraaaaal.rdd..peerlaaalseevaallaryplrelatrseklpveVdR 179
                   ++k+ a   ++lel+eG +ll+r+aer +    aa++ +a++l +     eer+a+ l++++ +ll+    re+++rs+++p+eV+R
  VIMSS2197508 118 RAKHGARLPLDLELREGDELLQRCAERGGPeiaAACAPLAERLqA-CqsVEERVALWLAAQTGELLRLVGPREHLVRSREYPLEVER 203
                   *************************98855888666666666642.2369************************************9 PP



Or compare VIMSS2197508 to CDD or PaperBLAST