PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS6861976 to PF11896 (DUF3416)

VIMSS6861976 has 576 amino acids

Query:       DUF3416  [M=179]
Accession:   PF11896.8
Description: Domain of unknown function (DUF3416)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence     Description
    ------- ------ -----    ------- ------ -----   ---- --  --------     -----------
    4.4e-30   91.4   0.0    7.7e-30   90.6   0.0    1.4  1  VIMSS6861976  


Domain annotation for each sequence (and alignments):
>> VIMSS6861976  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   90.6   0.0   7.7e-30   7.7e-30       3      88 ..      11      96 ..       9     101 .. 0.97

  Alignments for each domain:
  == domain 1  score: 90.6 bits;  conditional E-value: 7.7e-30
       DUF3416  3 iaIedvsPevdgGrfpaKavvGetvpVeAdvfrdGhdalaAtlvlrragekewqevpMtpggndrweasftpdelGryeftveAWv 88
                  ++Ie+++P+++gGrf  K+  G+tv+ +Ad+fr  h++  A++ +r+ ++k+w+++pM+ ++nd we+sft+ ++G ye+++ AW+
  VIMSS6861976 11 LVIENIRPSIEGGRFMLKREPGDTVTLQADIFRHSHEKYDAAIFYRHVSKKKWEQAPMHFVDNDLWEGSFTVGNIGYYEYKICAWT 96
                  68*********************************************************999***********************7 PP



Or compare VIMSS6861976 to CDD or PaperBLAST