VIMSS6861976 has 576 amino acids
Query: GlgE_dom_N_S [M=179]
Accession: PF11896.12
Description: Alpha-1,4-glucan:maltose-1-phosphate maltosyltransferase, domain N/S
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
4.1e-30 91.5 0.0 7.3e-30 90.7 0.0 1.4 1 VIMSS6861976
Domain annotation for each sequence (and alignments):
>> VIMSS6861976
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 90.7 0.0 7.3e-30 7.3e-30 3 88 .. 11 96 .. 9 100 .. 0.97
Alignments for each domain:
== domain 1 score: 90.7 bits; conditional E-value: 7.3e-30
GlgE_dom_N_S 3 ivIedVsPevdgGrfpaKavvGeeveVeAdvfrdGhdavaatvvlraegekewrevpMtpggnDrweaeftldeeGrwefrveAWs 88
+vIe+++P+++gGrf K+ G++v+ +Ad+fr+ h++ a++ +r+ ++k+w+++pM+ +nD we++ft+ ++G +e+++ AW+
VIMSS6861976 11 LVIENIRPSIEGGRFMLKREPGDTVTLQADIFRHSHEKYDAAIFYRHVSKKKWEQAPMHFVDNDLWEGSFTVGNIGYYEYKICAWT 96
79********************************************999**********999***********************7 PP
Or compare VIMSS6861976 to CDD or PaperBLAST