VIMSS742010 has 1148 amino acids
Query: GlgE_dom_N_S [M=179] Accession: PF11896.12 Description: Alpha-1,4-glucan:maltose-1-phosphate maltosyltransferase, domain N/S Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.3e-56 177.0 10.4 2.3e-56 177.0 10.4 2.3 3 VIMSS742010 Domain annotation for each sequence (and alignments): >> VIMSS742010 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -2.3 0.2 0.25 0.25 142 165 .. 97 120 .. 75 163 .. 0.58 2 ? -3.3 0.2 0.51 0.51 133 163 .. 156 186 .. 138 196 .. 0.49 3 ! 177.0 10.4 2.3e-56 2.3e-56 1 179 [] 478 664 .. 478 664 .. 0.98 Alignments for each domain: == domain 1 score: -2.3 bits; conditional E-value: 0.25 GlgE_dom_N_S 142 peerlaaalspelaallarhplre 165 e+ l++a++ +++++++hpl++ VIMSS742010 97 REHGLRIAVEVVVDRVAREHPLHD 120 444444444444444444444443 PP == domain 2 score: -3.3 bits; conditional E-value: 0.51 GlgE_dom_N_S 133 aaaaalrdepeerlaaalspelaallarhpl 163 aa++al+d ++rl a+ ++ aa+l ++p+ VIMSS742010 156 AALDALADWWRARLGALADAGAAAFLVDAPQ 186 3333333334445555554444444444444 PP == domain 3 score: 177.0 bits; conditional E-value: 2.3e-56 GlgE_dom_N_S 1 grivIedVsPevdgGrfpaKavvGeeveVeAdvfrdGhdavaatvvlraegekewrevpMtpggnDrweaeftldeeGrwefrveAWsDpfatWrhd 97 +ri+Ie+++P+vd+Grf++K+v+Ge++ V+A +f+dGh ++aa+v++ra++e+ w+e++ +++gnD w+a ++l+++Gr+ frv AW+D++at ++ VIMSS742010 478 ERIAIERIEPVVDDGRFAVKRVIGERLAVRAAIFADGHARLAAAVQWRAADENGWHEARCAAEGNDAWRADIPLERLGRHLFRVIAWRDDWATLVDE 574 59**********************************************99***********999********************************* PP GlgE_dom_N_S 98 lekkveagqdveleleeGaelleraaeraee......ealraaaaalrde.peerlaaalspelaallarhplrelvtrsek.lpvlvdR 179 + kk++agq v+lelee+++l +++ +ra e ++lr++aaal+++ p++rla++ +p++a+++a+ ++r+++tr ++ +pv+v+R VIMSS742010 575 IGKKHAAGQAVALELEEARRLAADVLTRAPEanpaalAVLREFAAALDAApPDQRLALIGAPHVADAFAALRERAFATRDAPvFPVDVER 664 **************************9997799999999********6667**************************************9 PP
Or compare VIMSS742010 to CDD or PaperBLAST