PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS742010 to PF11896 (DUF3416)

VIMSS742010 has 1148 amino acids

Query:       DUF3416  [M=179]
Accession:   PF11896.8
Description: Domain of unknown function (DUF3416)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    2.3e-55  173.8  10.5    2.3e-55  173.8  10.5    2.4  2  VIMSS742010  


Domain annotation for each sequence (and alignments):
>> VIMSS742010  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   -2.3   0.6      0.26      0.26     136     136 ..     123     123 ..      74     190 .. 0.57
   2 !  173.8  10.5   2.3e-55   2.3e-55       1     179 []     478     664 ..     478     664 .. 0.97

  Alignments for each domain:
  == domain 1  score: -2.3 bits;  conditional E-value: 0.26
      DUF3416 136 a 136
                  +
  VIMSS742010 123 R 123
                  2 PP

  == domain 2  score: 173.8 bits;  conditional E-value: 2.3e-55
      DUF3416   1 griaIedvsPevdgGrfpaKavvGetvpVeAdvfrdGhdalaAtlvlrragekewqevpMtpggndrweasftpdelGryeftveAWvDpfatWrhdl 98 
                  +riaIe+++P+vd+Grf++K+v+Ge++ V+A++f+dGh +laA++ +r+a+e+ w+e++  ++gnd w+a +++++lGr+ f+v AW+D++at ++++
  VIMSS742010 478 ERIAIERIEPVVDDGRFAVKRVIGERLAVRAAIFADGHARLAAAVQWRAADENGWHEARCAAEGNDAWRADIPLERLGRHLFRVIAWRDDWATLVDEI 575
                  59***********************************************************999********************************** PP

      DUF3416  99 ekkveagqdveleleeGarlleraaeraea......aalraaaaalrdd.peerlaaalseevaallaryplrelatrsek.lpveVdR 179
                   kk++agq v+lelee++rl +++++ra +      a+lr++aaal+++ p++rla++ +++va+++a+ ++r +atr ++ +pv+V+R
  VIMSS742010 576 GKKHAAGQAVALELEEARRLAADVLTRAPEanpaalAVLREFAAALDAApPDQRLALIGAPHVADAFAALRERAFATRDAPvFPVDVER 664
                  *************************9997799999999********5556**************************************9 PP



Or compare VIMSS742010 to CDD or PaperBLAST