PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS7523512 to PF11896 (DUF3416)

VIMSS7523512 has 653 amino acids

Query:       DUF3416  [M=179]
Accession:   PF11896.8
Description: Domain of unknown function (DUF3416)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence     Description
    ------- ------ -----    ------- ------ -----   ---- --  --------     -----------
      1e-55  175.0   0.5    1.4e-55  174.5   0.5    1.2  1  VIMSS7523512  


Domain annotation for each sequence (and alignments):
>> VIMSS7523512  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  174.5   0.5   1.4e-55   1.4e-55       2     179 .]       8     195 ..       7     195 .. 0.93

  Alignments for each domain:
  == domain 1  score: 174.5 bits;  conditional E-value: 1.4e-55
       DUF3416   2 riaIedvsPevdgGrfpaKavvGetvpVeAdvfrdGhdalaAtlvlrragekewqevpMtpggndrweasftpdelGryeftveAWvDpfatWrhdl 98 
                   r+ Ie+v+P+vdgGrfp+K+vvGe+v V+Ad++++Ghd+laA l +r+ gek+wqe pMt+g+ndrw+++ft++++Gr+e+t+e++ +++ +W++++
  VIMSS7523512   8 RVIIEAVEPQVDGGRFPIKRVVGEKVAVSADIYKEGHDKLAAVLKVRKVGEKKWQESPMTQGDNDRWQGEFTVTAVGRWEYTIEGYAERYLSWVDEI 104
                   9************************************************************************************************ PP

       DUF3416  99 ekkveagqdveleleeGarlleraaeraea....aalraaaaalrdd.....peerlaaalseevaallaryplrelatrsek.lpveVdR 179
                   +kk   g  +++el+eG  +l++ a+ a+a     +++ ++aa++++     ++ ++++ +   +++++aryp+r+   + ++ l++ V+R
  VIMSS7523512 105 TKKNVGGATLSSELLEGLVILKKSAAAAAAggdrTRMNGIIAAMESAlaageQQGAIDMGIGTVMRSMMARYPDRSEGYELAPaLKIMVNR 195
                   ***********************99887669999777777777733333345889*********************999999999999988 PP



Or compare VIMSS7523512 to CDD or PaperBLAST