PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS884866 to PF11896 (DUF3416)

VIMSS884866 has 672 amino acids

Query:       DUF3416  [M=179]
Accession:   PF11896.8
Description: Domain of unknown function (DUF3416)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    4.6e-55  172.8   0.1    6.6e-55  172.3   0.1    1.2  1  VIMSS884866  


Domain annotation for each sequence (and alignments):
>> VIMSS884866  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  172.3   0.1   6.6e-55   6.6e-55       2     179 .]      32     213 ..      31     213 .. 0.96

  Alignments for each domain:
  == domain 1  score: 172.3 bits;  conditional E-value: 6.6e-55
      DUF3416   2 riaIedvsPevdgGrfpaKavvGetvpVeAdvfrdGhdalaAtlvlrragekewqevpMtpggndrweasftpdelGryeftveAWvDpfatWrhdle 99 
                  ri+Ied  P++dgG f+aKa++G+ v+V+ +v++dGhd++a+++ +r+a+e++w+++pM+++gnd w ++ftp+++ r+ f+ eAW+D+f+++r +le
  VIMSS884866  32 RIVIEDTLPVIDGGLFAAKAIIGQPVTVTSKVYADGHDKMAVNIRWRAADEEHWHSAPMRELGNDSWVGEFTPTSVSRHVFRLEAWIDQFGSYRYELE 129
                  9************************************************************************************************* PP

      DUF3416 100 kkveagqdveleleeGarlleraaeraea...aalraaaaal.rdd.peerlaaalseevaallaryplrelatrseklpveVdR 179
                  kk+ ag  v+leleeG+  l +aaer+++   ++++ ++ +l +   ++e++a++l++e+a+l++ ++++ +++rs ++p++V+R
  VIMSS884866 130 KKFGAGVPVDLELEEGRIHLVHAAERSQNeqrQQIEGLLGQLeQ-GdKDEKVALLLHSETASLMKLADNQAFLSRSVEFPLDVER 213
                  ************************99977888889999999944.45*************************************9 PP



Or compare VIMSS884866 to CDD or PaperBLAST