WP_004552914.1 has 1136 amino acids
Query: GlgE_dom_N_S [M=179] Accession: PF11896.12 Description: Alpha-1,4-glucan:maltose-1-phosphate maltosyltransferase, domain N/S Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.1e-56 177.2 10.6 2.1e-56 177.2 10.6 2.4 3 WP_004552914.1 Domain annotation for each sequence (and alignments): >> WP_004552914.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -2.6 0.2 0.32 0.32 142 165 .. 85 108 .. 66 151 .. 0.56 2 ? -3.5 0.2 0.62 0.62 132 163 .. 143 174 .. 127 180 .. 0.48 3 ! 177.2 10.6 2.1e-56 2.1e-56 1 179 [] 466 652 .. 466 652 .. 0.97 Alignments for each domain: == domain 1 score: -2.6 bits; conditional E-value: 0.32 GlgE_dom_N_S 142 peerlaaalspelaallarhplre 165 e+ l++a++ +++++++hpl++ WP_004552914.1 85 REHGLRVAVEVVVDRVAREHPLHD 108 333444444444444444444433 PP == domain 2 score: -3.5 bits; conditional E-value: 0.62 GlgE_dom_N_S 132 raaaaalrdepeerlaaalspelaallarhpl 163 +aa++al+d ++rl a+ ++ aa+l ++p+ WP_004552914.1 143 AAALDALADWWRARLGALADAGAAAFLVDAPQ 174 33333343334455555555555555555544 PP == domain 3 score: 177.2 bits; conditional E-value: 2.1e-56 GlgE_dom_N_S 1 grivIedVsPevdgGrfpaKavvGeeveVeAdvfrdGhdavaatvvlraegekewrevpMtpggnDrweaeftldeeGrwefrveAWsDpfatWr 95 +ri+Ie+++P+vd+Grf++K+v+Ge++ V+A +f+dGh ++aa+v++ra++e+ w+e++ +++gnD w+a ++l+++Gr+ frv AW+D++at WP_004552914.1 466 ERIAIERIEPVVDDGRFAVKRVIGERLAVRAAIFADGHARLAAAVQWRAADENGWHEARCAAEGNDAWRADIPLERLGRHLFRVIAWRDDWATLV 560 59**********************************************99***********999******************************* PP GlgE_dom_N_S 96 hdlekkveagqdveleleeGaelleraaeraee......ealraaaaalrde.peerlaaalspelaallarhplrelvtrsek.lpvlvdR 179 +++ kk++agq v+lelee+++l +++ +ra e ++lr++aaal+++ p++rla++ +p++a+++a+ ++r+++tr ++ +pv+v+R WP_004552914.1 561 DEIGKKHAAGQAVALELEEARRLAADVLARAPEanpaalAVLREFAAALDAApPDQRLALIGAPHVADAFAALRERAFATRDAPvFPVDVER 652 ****************************9997799999999********6667**************************************9 PP
Or compare WP_004552914.1 to CDD or PaperBLAST