WP_013234303.1 has 1132 amino acids
Query: GlgE_dom_N_S [M=179] Accession: PF11896.12 Description: Alpha-1,4-glucan:maltose-1-phosphate maltosyltransferase, domain N/S Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.8e-59 187.2 1.5 3.2e-59 186.4 1.5 1.4 1 WP_013234303.1 Domain annotation for each sequence (and alignments): >> WP_013234303.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 186.4 1.5 3.2e-59 3.2e-59 1 179 [] 444 649 .. 444 649 .. 0.90 Alignments for each domain: == domain 1 score: 186.4 bits; conditional E-value: 3.2e-59 GlgE_dom_N_S 1 grivIedVsPevdgGrfpaKavvGeeveVeAdvfrdGhdavaatvvlraegekewrevpMtpggnDrweaeftldeeGrwefrveAWsDpfatWr 95 +ri+Ie+VsP+vd+G+f+aK++vGe++ + Ad+f+dGhd++aa+v++ra++e++wr++pM+p+ nDrw+a+++l+++Gr+ f +eAWsD f t+r WP_013234303.1 444 RRIAIERVSPAVDDGAFAAKRIVGEHFVIAADIFMDGHDHLAAEVLVRAADEAQWRRIPMHPDVNDRWQARVSLTRLGRHYFCIEAWSDVFDTFR 538 59**********************************************99********************************************* PP GlgE_dom_N_S 96 hdlekkveagqdveleleeGaelleraaeraee........ealraaaaal..............rdepeerlaaalspelaallar....hplr 164 ++l+kk+ agqdv+le+eeG+ l++r+ +ra e e ra+++al +++ ++rla ++++e+++l+++ + +r WP_013234303.1 539 DGLQKKLMAGQDVSLEMEEGRLLIARLVQRAVEqelepsvlESSRALLKALggppsktrrsaagkQADTDKRLAFLCAEETRQLVEQltglAGER 633 ****************************9996699999888666777777777787776555443344999***********999872222568* PP GlgE_dom_N_S 165 elvtrsek.lpvlvdR 179 ++++r+++ +p++++R WP_013234303.1 634 AFLSRTDAeYPLEAER 649 **************99 PP
Or compare WP_013234303.1 to CDD or PaperBLAST