PaperBLAST – Find papers about a protein or its homologs

 

Align WP_013234303.1 to PF11896 (DUF3416)

WP_013234303.1 has 1132 amino acids

Query:       DUF3416  [M=179]
Accession:   PF11896.8
Description: Domain of unknown function (DUF3416)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
    1.8e-61  193.7   1.5    3.2e-61  192.9   1.5    1.4  1  WP_013234303.1  


Domain annotation for each sequence (and alignments):
>> WP_013234303.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  192.9   1.5   3.2e-61   3.2e-61       1     179 []     444     649 ..     444     649 .. 0.88

  Alignments for each domain:
  == domain 1  score: 192.9 bits;  conditional E-value: 3.2e-61
         DUF3416   1 griaIedvsPevdgGrfpaKavvGetvpVeAdvfrdGhdalaAtlvlrragekewqevpMtpggndrweasftpdelGryeftveAWvDpfatWr 95 
                     +riaIe+vsP+vd+G+f+aK++vGe++++ Ad+f+dGhd+laA++++r+a+e++w+++pM+p++ndrw+a++++++lGr+ f++eAW+D f+t+r
  WP_013234303.1 444 RRIAIERVSPAVDDGAFAAKRIVGEHFVIAADIFMDGHDHLAAEVLVRAADEAQWRRIPMHPDVNDRWQARVSLTRLGRHYFCIEAWSDVFDTFR 538
                     59********************************************************************************************* PP

         DUF3416  96 hdlekkveagqdveleleeGarlleraaeraea........aalraaaaal..............rddpeerlaaalseevaallar....yplr 164
                     ++l+kk+ agqdv+le+eeG+ l++r+++ra +        +  ra+++al              ++d+++rla++++ee+++l+++    + +r
  WP_013234303.1 539 DGLQKKLMAGQDVSLEMEEGRLLIARLVQRAVEqelepsvlESSRALLKALggppsktrrsaagkQADTDKRLAFLCAEETRQLVEQltglAGER 633
                     ****************************9995599999888445555555555565555444333555899**********9888762222679* PP

         DUF3416 165 elatrsek.lpveVdR 179
                      +++r+++ +p+e++R
  WP_013234303.1 634 AFLSRTDAeYPLEAER 649
                     **************99 PP



Or compare WP_013234303.1 to CDD or PaperBLAST