PaperBLAST – Find papers about a protein or its homologs

 

Align WP_076879897.1 to PF11896 (DUF3416)

WP_076879897.1 has 1148 amino acids

Query:       DUF3416  [M=179]
Accession:   PF11896.8
Description: Domain of unknown function (DUF3416)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
      2e-55  174.0  10.8      2e-55  174.0  10.8    2.4  2  WP_076879897.1  


Domain annotation for each sequence (and alignments):
>> WP_076879897.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   -3.3   1.5      0.53      0.53      55      86 ..     153     184 ..      94     205 .. 0.58
   2 !  174.0  10.8     2e-55     2e-55       1     179 []     478     664 ..     478     664 .. 0.97

  Alignments for each domain:
  == domain 1  score: -3.3 bits;  conditional E-value: 0.53
         DUF3416  55 wqevpMtpggndrweasf.tpdelGryeftveA 86 
                      + +++ ++  d w+a++  +   G  +f v+A
  WP_076879897.1 153 GSAAALDAL-ADWWRARLgALADAGAAAFLVDA 184
                     223334444.44444444223444444444444 PP

  == domain 2  score: 174.0 bits;  conditional E-value: 2e-55
         DUF3416   1 griaIedvsPevdgGrfpaKavvGetvpVeAdvfrdGhdalaAtlvlrragekewqevpMtpggndrweasftpdelGryeftveAWvDpfatWr 95 
                     +riaIe+++P+vd+Grf++K+v+Ge++ V+A++f+dGh +laA++ +r+a+e+ w+e++  ++gnd w+a +++++lGr+ f+v AW+D++at +
  WP_076879897.1 478 ERIAIERIEPVVDDGRFAVKRVIGERLAVRAAIFADGHARLAAAVQWRAADENGWHEARCAAEGNDAWRADIPLERLGRHLFRVIAWRDDWATLV 572
                     59***********************************************************999******************************* PP

         DUF3416  96 hdlekkveagqdveleleeGarlleraaeraea......aalraaaaalrdd.peerlaaalseevaallaryplrelatrsek.lpveVdR 179
                     +++ kk++agq v+lelee++rl +++++ra +      a+lr++aaal+++ p++rla++ +++va+++a+ ++r +atr ++ +pv+V+R
  WP_076879897.1 573 DEIGKKHAAGQAVALELEEARRLAADVLARAPEanpaalAVLREFAAALDAApPDQRLALIGAPHVADAFAALRERAFATRDAPvFPVDVER 664
                     ****************************9997699999999********5556**************************************9 PP



Or compare WP_076879897.1 to CDD or PaperBLAST