PaperBLAST – Find papers about a protein or its homologs

 

Align BRENDA::A4H320 to PF11901 (DUF3421)

BRENDA::A4H320 has 249 amino acids

Query:       DUF3421  [M=115]
Accession:   PF11901.8
Description: Protein of unknown function (DUF3421)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
      9e-50  153.8   4.6      1e-46  143.9   1.7    2.3  2  BRENDA::A4H320  


Domain annotation for each sequence (and alignments):
>> BRENDA::A4H320  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   11.9   0.0   9.5e-06   9.5e-06      54      76 ..     109     131 ..     104     133 .. 0.88
   2 !  143.9   1.7     1e-46     1e-46       3     115 .]     130     239 ..     129     239 .. 0.97

  Alignments for each domain:
  == domain 1  score: 11.9 bits;  conditional E-value: 9.5e-06
                     EEEEEEEETT---......TTB- CS
         DUF3421  54 eleWvpssdgqvpkgAvegGrse 76 
                     ++ W ++s+g +p+gAvegG+++
  BRENDA::A4H320 109 DFCWCDASGGVIPPGAVEGGKDD 131
                     689*****************875 PP

  == domain 2  score: 143.9 bits;  conditional E-value: 1e-46
                     TSBEEEEEEEEETTEEEEEEE-TTSSSEEEEETTEEEEESEEEEEETTSB-EEEEEEEETT---......TTB-EETTEEEEEEEETTEEEEEEE CS
         DUF3421   3 dgspiYvgRakhegsvlpgkvvpekkaayvsyggkehekseyevLvakdpseleWvpssdgqvpkgAvegGrsedgepLyigrakvegslvpGkv 97 
                     d +++YvgRa+heg +lpgkv p + ++yv++gg eh k+ey+vL+    ++ +Wvp+++ ++p++A+ +G +edgepLy+gr+++e+++++Gkv
  BRENDA::A4H320 130 DDESLYVGRAYHEGALLPGKVKPGHAVCYVAWGGGEHGKTEYQVLCG---CNPVWVPTTGNNIPHNAIPAGETEDGEPLYVGRVQHEDTVTIGKV 221
                     6789******************************************4...899****************************************** PP

                     ETTTTEEEEEETTEEEEE CS
         DUF3421  98 hpshkvayipyggkEvsv 115
                     +psh+v+yipygg Ev++
  BRENDA::A4H320 222 QPSHSVCYIPYGGAEVAF 239
                     ***************975 PP



Or compare BRENDA::A4H320 to CDD or PaperBLAST