PaperBLAST – Find papers about a protein or its homologs

 

Align BRENDA::B2Z3X2 to PF11901 (DUF3421)

BRENDA::B2Z3X2 has 146 amino acids

Query:       DUF3421  [M=115]
Accession:   PF11901.8
Description: Protein of unknown function (DUF3421)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
    2.6e-49  152.3   3.3    6.5e-46  141.3   0.7    2.4  3  BRENDA::B2Z3X2  


Domain annotation for each sequence (and alignments):
>> BRENDA::B2Z3X2  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   13.0   0.0   4.2e-06   4.2e-06      54      84 ..       3      34 ..       1      34 [. 0.88
   2 !  141.3   0.7   6.5e-46   6.5e-46       1     114 [.      25     135 ..      25     136 .. 0.98
   3 !    9.2   0.0   6.3e-05   6.3e-05      31      49 ..     126     144 ..     126     146 .] 0.90

  Alignments for each domain:
  == domain 1  score: 13.0 bits;  conditional E-value: 4.2e-06
                    EEEEEEEE.TT---......TTB-EETTEEEE CS
         DUF3421 54 eleWvpss.dgqvpkgAvegGrsedgepLyig 84
                    e +Wv+++ d ++p+ Av++G+++dg p+++g
  BRENDA::B2Z3X2  3 EHHWVSTTiDSELPPFAVQAGHDSDGSPIFVG 34
                    5799998746899*****************98 PP

  == domain 2  score: 141.3 bits;  conditional E-value: 6.5e-46
                     -TTSBEEEEEEEEETTEEEEEEE-TTSSSEEEEETTEEEEESEEEEEETTSB-EEEEEEEETT---......TTB-EETTEEEEEEEETTEEEEE CS
         DUF3421   1 dsdgspiYvgRakhegsvlpgkvvpekkaayvsyggkehekseyevLvakdpseleWvpssdgqvpkgAvegGrsedgepLyigrakvegslvpG 95 
                     dsdgspi+vgRa+h+g++l++k+vp+k++ayv++gg+e++k++ evL+    ++++Wvp+ +g+vp+gAv +G+++ ge Ly+gr+ + +sl+pG
  BRENDA::B2Z3X2  25 DSDGSPIFVGRAYHNGDMLVAKIVPNKGQAYVAWGGEEVNKHDIEVLTG---HNYHWVPDANGAVPAGAVACGQTSLGETLYVGRGYHADSLTPG 116
                     789*********************************************4...89***************************************** PP

                     EEETTTTEEEEEETTEEEE CS
         DUF3421  96 kvhpshkvayipyggkEvs 114
                     k+hps++++yi +gg+Ev+
  BRENDA::B2Z3X2 117 KIHPSQGCLYIGFGGEEVT 135
                     *****************96 PP

  == domain 3  score: 9.2 bits;  conditional E-value: 6.3e-05
                     EEEETTEEEEESEEEEEET CS
         DUF3421  31 yvsyggkehekseyevLva 49 
                     y+ +gg+e+++++yevLv+
  BRENDA::B2Z3X2 126 YIGFGGEEVTLTNYEVLVR 144
                     789**************94 PP



Or compare BRENDA::B2Z3X2 to CDD or PaperBLAST