PaperBLAST – Find papers about a protein or its homologs

 

Align NP_611544.1 to PF11901 (DUF3421)

NP_611544.1 has 296 amino acids

Query:       DUF3421  [M=115]
Accession:   PF11901.8
Description: Protein of unknown function (DUF3421)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    8.8e-64  198.9   2.5    6.8e-46  141.3   0.2    2.2  2  NP_611544.1  


Domain annotation for each sequence (and alignments):
>> NP_611544.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   65.1   0.1   2.8e-22   2.8e-22      55     113 ..     157     214 ..     152     216 .. 0.95
   2 !  141.3   0.2   6.8e-46   6.8e-46       3     114 ..     178     286 ..     177     287 .. 0.97

  Alignments for each domain:
  == domain 1  score: 65.1 bits;  conditional E-value: 2.8e-22
                  EEEEEEETT---......TTB-EETTEEEEEEEETTEEEEEEEETTTTEEEEEETTEEE CS
      DUF3421  55 leWvpssdgqvpkgAvegGrsedgepLyigrakvegslvpGkvhpshkvayipyggkEv 113
                    Wvp+ +g+vp++A+egG+++  e+Lyi+ra++eg l+pGk+hpsh+v y+++gg E+
  NP_611544.1 157 GCWVPAANGEVPPNALEGGFDS-SEQLYIARARHEGDLIPGKLHPSHGVTYVAWGGGEH 214
                  57******************98.9**********************************8 PP

  == domain 2  score: 141.3 bits;  conditional E-value: 6.8e-46
                  TSBEEEEEEEEETTEEEEEEE-TTSSSEEEEETTEEEEESEEEEEETTSB-EEEEEEEETT---......TTB-EETTEEEEEEEETTEEEEEEEETT CS
      DUF3421   3 dgspiYvgRakhegsvlpgkvvpekkaayvsyggkehekseyevLvakdpseleWvpssdgqvpkgAvegGrsedgepLyigrakvegslvpGkvhps 100
                  +++++Y++Ra+heg+++pgk+ p++++ yv++gg eh + eyevL+a      +W p   g++p++A+ +G +++gepL+igra+++g++++Gkv+ps
  NP_611544.1 178 SSEQLYIARARHEGDLIPGKLHPSHGVTYVAWGGGEHGHAEYEVLCA---GGGQWLPVDAGNIPPNALPAGETAEGEPLFIGRATHDGTITVGKVQPS 272
                  5789******************************************5...68********************************************** PP

                  TTEEEEEETTEEEE CS
      DUF3421 101 hkvayipyggkEvs 114
                  h+++yipygg+E++
  NP_611544.1 273 HGCCYIPYGGEELA 286
                  ************86 PP



Or compare NP_611544.1 to CDD or PaperBLAST