PaperBLAST – Find papers about a protein or its homologs

 

Align NP_649021.1 to PF11901 (DUF3421)

NP_649021.1 has 180 amino acids

Query:       DUF3421  [M=115]
Accession:   PF11901.8
Description: Protein of unknown function (DUF3421)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    1.7e-33  101.3   0.4    1.6e-32   98.2   0.1    2.4  3  NP_649021.1  


Domain annotation for each sequence (and alignments):
>> NP_649021.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    0.6   0.0     0.031     0.031      56      76 ..      27      48 ..      15      50 .. 0.68
   2 !   98.2   0.1   1.6e-32   1.6e-32       2     111 ..      48     158 ..      47     162 .. 0.93
   3 !    3.8   0.0     0.003     0.003      27      49 ..     148     171 ..     147     179 .. 0.80

  Alignments for each domain:
  == domain 1  score: 0.6 bits;  conditional E-value: 0.031
                 EEEEEET.T---......TTB- CS
      DUF3421 56 eWvpssd.gqvpkgAvegGrse 76
                 +W   +    +p +Av+gG++ 
  NP_649021.1 27 VWKAGNLsYVIPYNAVVGGFDP 48
                 55555431458999*****876 PP

  == domain 2  score: 98.2 bits;  conditional E-value: 1.6e-32
                  TTSBEEEEEEEEETTEEEEEEE-TTSSSEEEEETTEEEEESEEEEEETTSB-EEEEEEEETT---......TTB-EETTEEEEEEEETTEEEEEEEET CS
      DUF3421   2 sdgspiYvgRakhegsvlpgkvvpekkaayvsyggkehekseyevLvakdpseleWvpssdgqvpkgAvegGrsedgepLyigrakvegslvpGkvhp 99 
                  ++g ++YvgR+k+++s+lp++vv+e+++ay   ++++ ++  y++Lva+++ +++Wv+s+dg ++kgAv +G++ ++e+++++rak++g++++G++  
  NP_649021.1  48 PYGFTTYVGRVKYSNSILPARVVAETGTAYFNTETTSSKLLVYDILVAERDVNYVWVRSFDGFYEKGAVAVGTTVKNERVFCCRAKTDGGILIGTLLL 145
                  57889******************************************99**********************************************876 PP

                  .TTTEEEEEETTE CS
      DUF3421 100 .shkvayipyggk 111
                   s+kv++i++++ 
  NP_649021.1 146 sSQKVCIIKHESL 158
                  3789999999875 PP

  == domain 3  score: 3.8 bits;  conditional E-value: 0.003
                  SSSEEEEETTEEEEE.SEEEEEET CS
      DUF3421  27 kkaayvsyggkehek.seyevLva 49 
                  +k++ + +++ + +k ++yevLva
  NP_649021.1 148 QKVCIIKHESLALRKfDKYEVLVA 171
                  56799999999999989******4 PP



Or compare NP_649021.1 to CDD or PaperBLAST