PaperBLAST – Find papers about a protein or its homologs

 

Align NP_649022.2 to PF11901 (DUF3421)

NP_649022.2 has 191 amino acids

Query:       DUF3421  [M=115]
Accession:   PF11901.8
Description: Protein of unknown function (DUF3421)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    2.9e-34  103.8   0.1    8.9e-34  102.2   0.0    1.8  2  NP_649022.2  


Domain annotation for each sequence (and alignments):
>> NP_649022.2  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  102.2   0.0   8.9e-34   8.9e-34       1     111 [.      51     161 ..      51     165 .. 0.95
   2 ?   -1.7   0.0      0.16      0.16      42      50 ..     167     175 ..     163     183 .. 0.73

  Alignments for each domain:
  == domain 1  score: 102.2 bits;  conditional E-value: 8.9e-34
                  -TTSBEEEEEEEEETTEEEEEEE-TTSSSEEEEETTEEEEESEEEEEETTSB-EEEEEEEETT---......TTB-EETTEEEEEEEETTEEEEEEEE CS
      DUF3421   1 dsdgspiYvgRakhegsvlpgkvvpekkaayvsyggkehekseyevLvakdpseleWvpssdgqvpkgAvegGrsedgepLyigrakvegslvpGkvh 98 
                  d+dg+ +YvgR+ +++++lp++vvpe ++a++  ++  ++ ++yevLv++++  ++W++s+dg  +k+Av++G+++  e+++i+r+++++s+++G+++
  NP_649022.2  51 DPDGYYTYVGRVTYSSNILPARVVPELGKATYNTDTLGNQATTYEVLVSNATVGYHWIRSFDGFREKNAVSVGTNALSERVFICRVRCDESIFIGTLY 148
                  6799***********************888888888888889******99************************************************ PP

                  TTTTEEEEEETTE CS
      DUF3421  99 pshkvayipyggk 111
                   s+++++++y++ 
  NP_649022.2 149 LSKRMCIVKYDNF 161
                  **********986 PP

  == domain 2  score: -1.7 bits;  conditional E-value: 0.16
                  SEEEEEETT CS
      DUF3421  42 seyevLvak 50 
                  ++ye+Lv++
  NP_649022.2 167 DKYEILVRE 175
                  79****942 PP



Or compare NP_649022.2 to CDD or PaperBLAST