PaperBLAST – Find papers about a protein or its homologs

 

Align XP_018645882.1 to PF11901 (DUF3421)

XP_018645882.1 has 79 amino acids

Query:       DUF3421  [M=115]
Accession:   PF11901.8
Description: Protein of unknown function (DUF3421)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
    5.1e-28   83.6   0.9    3.5e-24   71.3   0.1    1.7  2  XP_018645882.1  


Domain annotation for each sequence (and alignments):
>> XP_018645882.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   71.3   0.1   3.5e-24   3.5e-24      53     114 ..       6      67 ..       2      68 .. 0.96
   2 !   16.6   0.1   3.3e-07   3.3e-07      29      48 ..      56      75 ..      55      79 .] 0.88

  Alignments for each domain:
  == domain 1  score: 71.3 bits;  conditional E-value: 3.5e-24
                     -EEEEEEEETT---......TTB-EETTEEEEEEEETTEEEEEEEETTTTEEEEEETTEEEE CS
         DUF3421  53 seleWvpssdgqvpkgAvegGrsedgepLyigrakvegslvpGkvhpshkvayipyggkEvs 114
                      ++ W++++dg+vpk+A+++G+ +dgepLyi ++ v+++++ Gk+h+ h++ay+p+ggkE s
  XP_018645882.1   6 DKYCWERAFDGNVPKNAIVAGIAKDGEPLYIVKGVVNNETCFGKLHEGHSCAYLPWGGKEYS 67 
                     689*********************************************************87 PP

  == domain 2  score: 16.6 bits;  conditional E-value: 3.3e-07
                    SEEEEETTEEEEESEEEEEE CS
         DUF3421 29 aayvsyggkehekseyevLv 48
                    +ay+++ggke++++ey+vLv
  XP_018645882.1 56 CAYLPWGGKEYSVNEYDVLV 75
                    79*****************9 PP



Or compare XP_018645882.1 to CDD or PaperBLAST