PaperBLAST – Find papers about a protein or its homologs

 

Align XP_318631.4 to PF11901 (DUF3421)

XP_318631.4 has 298 amino acids

Query:       DUF3421  [M=115]
Accession:   PF11901.8
Description: Protein of unknown function (DUF3421)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    5.2e-49  151.3   1.7    1.1e-45  140.7   0.3    2.5  3  XP_318631.4  


Domain annotation for each sequence (and alignments):
>> XP_318631.4  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   -3.7   0.0      0.63      0.63      51      65 ..      10      24 ..       6      26 .. 0.78
   2 !   11.3   0.1   1.4e-05   1.4e-05      55      75 ..     160     180 ..     153     183 .. 0.87
   3 !  140.7   0.3   1.1e-45   1.1e-45       2     114 ..     179     288 ..     178     289 .. 0.97

  Alignments for each domain:
  == domain 1  score: -3.7 bits;  conditional E-value: 0.63
                 SB-EEEEEEEETT-- CS
      DUF3421 51 dpseleWvpssdgqv 65
                 d+ e+++vp+ +g v
  XP_318631.4 10 DKLEYRFVPAGNGVV 24
                 667899999999876 PP

  == domain 2  score: 11.3 bits;  conditional E-value: 1.4e-05
                  EEEEEEETT---......TTB CS
      DUF3421  55 leWvpssdgqvpkgAvegGrs 75 
                    Wv + +g++p++Av+gG +
  XP_318631.4 160 ACWVAAANGEIPPNAVVGGSD 180
                  57*****************75 PP

  == domain 3  score: 140.7 bits;  conditional E-value: 1.1e-45
                  TTSBEEEEEEEEETTEEEEEEE-TTSSSEEEEETTEEEEESEEEEEETTSB-EEEEEEEETT---......TTB-EETTEEEEEEEETTEEEEEEEET CS
      DUF3421   2 sdgspiYvgRakhegsvlpgkvvpekkaayvsyggkehekseyevLvakdpseleWvpssdgqvpkgAvegGrsedgepLyigrakvegslvpGkvhp 99 
                  sdg+++Y+gRa+heg ++pgkvv++++++y+++gg e+ k eyevL++      e+vp+s+ ++p+ A+ +G sedgepL+igr+++eg++++Gkv+p
  XP_318631.4 179 SDGEDMYIGRAQHEGGIIPGKVVASHGVCYIAWGGAENPKAEYEVLCD---FGGEFVPASGSDIPPTALPAGESEDGEPLFIGRVTHEGTVTVGKVQP 273
                  689********************************************4...679******************************************** PP

                  TTTEEEEEETTEEEE CS
      DUF3421 100 shkvayipyggkEvs 114
                  sh+v+yipygg+E++
  XP_318631.4 274 SHGVCYIPYGGQELA 288
                  *************97 PP



Or compare XP_318631.4 to CDD or PaperBLAST