PaperBLAST – Find papers about a protein or its homologs

 

Align NP_649580.1 to PF11935 (DUF3453)

NP_649580.1 has 1165 amino acids

Query:       DUF3453  [M=226]
Accession:   PF11935.8
Description: Domain of unknown function (DUF3453)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    3.1e-58  183.2   0.1    3.1e-58  183.2   0.1    2.7  4  NP_649580.1  


Domain annotation for each sequence (and alignments):
>> NP_649580.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   -1.9   0.1      0.12      0.12      41      68 ..      69      95 ..      61     111 .. 0.71
   2 !  183.2   0.1   3.1e-58   3.1e-58       2     220 ..     117     336 ..     116     343 .. 0.91
   3 ?   -3.2   0.0      0.29      0.29     142     177 ..     701     735 ..     696     742 .. 0.74
   4 ?   -2.6   0.2      0.19      0.19     120     140 ..     971     991 ..     919    1031 .. 0.64

  Alignments for each domain:
  == domain 1  score: -1.9 bits;  conditional E-value: 0.12
      DUF3453 41 deIlrlvdssdndgvrlaaiKFiervil 68
                 +++l+l  +s n+ vr +++ F+e+v  
  NP_649580.1 69 ESVLSLAHDS-NMEVRKQVVAFVEQVCK 95
                 5667774434.48888888888888754 PP

  == domain 2  score: 183.2 bits;  conditional E-value: 3.1e-58
      DUF3453   2 pavvkkvIqaaasiYplvlrliikns...eds.etWekmtalKdeIlrlvdssdndgvrlaaiKFiervilvqtrgvadrnes.keqseislsqvpdn 94 
                  ++v+k+vIqa+ siY++ l+++++     +++ ++W+ ++ +K +Il+++d ++ndg+r++aiKF+e v+++q+     +++s k++ ++sl++vp +
  NP_649580.1 117 AQVIKRVIQACGSIYKNGLQYLCSLMepgDSAeQAWNILSLIKAQILDMID-NENDGIRTNAIKFLEGVVVLQSFA---DEDSlKRDGDFSLADVP-D 209
                  68*********************9444565556******************.666*******************88...344568889********.6 PP

      DUF3453  95 hpil.sprkLeaEAkrlLdrlLkvlqeasiltsslviatlnslasiakqRpqfankilqallsfnplkkpnlpptlsklqvksvektlkvlllnllkn 191
                  h++l + +kL++E++++Ld+lL+ ++  ++++s ++ia+ +sl++iak+Rp f+  +++a++++n+    nlpptl+ +qv+sv+k+lk++l+ llkn
  NP_649580.1 210 HCTLfRREKLQEEGNNILDILLQ-FHGTTHISSVNLIACTSSLCTIAKMRPIFMGAVVEAFKQLNA----NLPPTLTDSQVSSVRKSLKMQLQTLLKN 302
                  66666******************.99999************************************9....**************************** PP

      DUF3453 192 ssehplqskiqqlleklgallqeiaavi.....a 220
                    + +++s+i  +l +lg++ +ei+++i     +
  NP_649580.1 303 RGAFEFASTIRGMLVDLGSSTNEIQKLIpkmdkQ 336
                  9*************************99865432 PP

  == domain 3  score: -3.2 bits;  conditional E-value: 0.29
      DUF3453 142 qRpqfankilqallsfnplkkpnlpptlsklqvksv 177
                   Rp   n+ + +ll+f +++     ++l +++  s+
  NP_649580.1 701 LRPPRKNRFVRVLLNFSVHER-LDLRDLAQAHLVSL 735
                  588888999********9777.66666777766665 PP

  == domain 4  score: -2.6 bits;  conditional E-value: 0.19
      DUF3453 120 easiltsslviatlnslasia 140
                  e +  t+ +++a+l++l+ ++
  NP_649580.1 971 ERDLYTQEVLMAVLQQLVEVT 991
                  334444445555555555443 PP



Or compare NP_649580.1 to CDD or PaperBLAST