PaperBLAST – Find papers about a protein or its homologs

 

Align SwissProt::Q10222 to PF11935 (DUF3453)

SwissProt::Q10222 has 670 amino acids

Query:       DUF3453  [M=226]
Accession:   PF11935.8
Description: Domain of unknown function (DUF3453)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence          Description
    ------- ------ -----    ------- ------ -----   ---- --  --------          -----------
    1.2e-48  151.8   1.2    3.1e-48  150.5   1.2    1.6  1  SwissProt::Q10222  


Domain annotation for each sequence (and alignments):
>> SwissProt::Q10222  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  150.5   1.2   3.1e-48   3.1e-48       2     206 ..      87     291 ..      86     308 .. 0.90

  Alignments for each domain:
  == domain 1  score: 150.5 bits;  conditional E-value: 3.1e-48
            DUF3453   2 pavvkkvIqaaasiYplvlrliiknsedsetWekmtalKdeIlrlvdssdndgvrlaaiKFiervilvqtrgvadrneskeqseislsqvpd 93 
                        ++v k vI+++++iYplv+ + +++++ds+tW+++t+lK+eI++ +d+++     +++iKFi+ vil+q +g+ d++    +s++sls+vp+
  SwissProt::Q10222  87 EEVKKDVISCSCTIYPLVFLHCCTSPNDSSTWDTLTKLKNEIINDFDKGN-KPLLISCIKFISCVILTQVPGIRDPRL-VTKSDVSLSKVPT 176
                        5799*******************************************887.*********************999555.567********** PP

            DUF3453  94 nhpilsprkLeaEAkrlLdrlLkvlqeasiltsslviatlnslasiakqRpqfankilqallsfnplkk..pnlpptlsklqvksvektlkv 183
                         hp+++ + L  EA++l++++ ++l + ++l+   ++++ln l +++k+R+++a+ki+ +ll+f+  +   + +  + skl+++++ek+lk 
  SwissProt::Q10222 177 HHPFINSNILRIEANDLIEKIFSILFS-DSLNVLYITSVLNILPVLVKRRKELAPKIIGSLLEFHLPNPkdEIELSNESKLAIRCIEKNLKL 267
                        ***********************9966.699999*******************************7555697888889************** PP

            DUF3453 184 lllnllk.nssehplqskiqqlle 206
                         ll+l k   +++    ki+++l+
  SwissProt::Q10222 268 ILLHLAKsTGASSSSVEKIHAYLS 291
                        *******53344777778888777 PP



Or compare SwissProt::Q10222 to CDD or PaperBLAST