PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS10081146 to PF11935 (DUF3453)

VIMSS10081146 has 264 amino acids

Query:       DUF3453  [M=226]
Accession:   PF11935.8
Description: Domain of unknown function (DUF3453)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence      Description
    ------- ------ -----    ------- ------ -----   ---- --  --------      -----------
    3.3e-38  117.7   0.0    5.3e-38  117.0   0.0    1.3  1  VIMSS10081146  


Domain annotation for each sequence (and alignments):
>> VIMSS10081146  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  117.0   0.0   5.3e-38   5.3e-38       1     134 [.     100     244 ..     100     252 .. 0.89

  Alignments for each domain:
  == domain 1  score: 117.0 bits;  conditional E-value: 5.3e-38
        DUF3453   1 dpavvkkvIqaaasiYplvlrliik.......nseds.etWekmtalKdeIlrl.vdssdndgvrlaaiKFiervilvqtrgvad...rnes..ke 82 
                    dp+v+kk+I+ ++++++ +l++++         +  + e+W++m+++Kd ++++ +++++ +gv++ a+KF+e++il++t++ +d      s  ++
  VIMSS10081146 100 DPTVAKKSISVGTTFFCTILEEMAMqfhhrgkVDRWCgELWTWMVKFKDTVFATaLEPGC-VGVKVLALKFMETFILLFTPDASDpekA--SseGS 192
                    799********************886655444224466**********************.*********************7776532..14699 PP

        DUF3453  83 qseislsqvpdnhpilsprkLeaEAkrlLdrlLkvlqeasiltsslviatln 134
                    ++++++s++  +hpil+p++L++EA+r++++l++++q+a++l+++l+i++++
  VIMSS10081146 193 RHMFNISWLAGGHPILNPATLMSEANRTFGILVDFIQSANRLPGALTISVIS 244
                    9***********************************************9997 PP



Or compare VIMSS10081146 to CDD or PaperBLAST