PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS10104004 to PF11935 (DUF3453)

VIMSS10104004 has 1467 amino acids

Query:       DUF3453  [M=226]
Accession:   PF11935.8
Description: Domain of unknown function (DUF3453)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence      Description
    ------- ------ -----    ------- ------ -----   ---- --  --------      -----------
    4.1e-45  140.3   0.0    3.8e-44  137.1   0.0    2.3  2  VIMSS10104004  


Domain annotation for each sequence (and alignments):
>> VIMSS10104004  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  137.1   0.0   3.8e-44   3.8e-44       1     196 [.      96     289 ..      96     311 .. 0.85
   2 ?   -0.2   0.1     0.037     0.037     116     162 ..    1112    1158 ..    1104    1193 .. 0.79

  Alignments for each domain:
  == domain 1  score: 137.1 bits;  conditional E-value: 3.8e-44
        DUF3453   1 dpavvkkvIqaaasiYplvlrliik........nseds.etWekmtalKdeIlrl.vdssdndgvrlaaiKFiervilvqtrgvadrneskeqsei 86 
                    +pav+++vI ++a +++++l++++         n+    + W+++ ++KdeI++  +++++  gv+l+a+KF+e +il+ t++      ++ + ++
  VIMSS10104004  96 TPAVARQVIACGADLFRSTLERVAVqglhsselNDL-LeSSWTWLIKFKDEICSVaFKQGN-SGVKLCAMKFVEALILLYTPH------EGIEADF 183
                    689********************8755544333333.359***************778666.*******************99......37789** PP

        DUF3453  87 slsqvpdnhpilsprkLeaEAkrlLdrlLkvlqeas..iltsslviatlnslasiakqRpqfankilqallsfnplkkpnlpptlsklqvksvekt 180
                    ++s+++ +hp+l++ +L  EA++ L++lL+ l++ +  +l+ss +i+++nsl+s+ak+Rp+++ +il++lls++pl+       l+ + ++  + +
  VIMSS10104004 184 NISILRGGHPVLKIGDLSIEASQKLGLLLDQLRHPAakSLNSSTIIVLINSLSSVAKKRPAYCGRILPVLLSLDPLSF------LKGVYAAATNLA 273
                    *******************************987544488999********************************443......79********** PP

        DUF3453 181 lkvlllnllknssehp 196
                    lk+++l++lk  + + 
  VIMSS10104004 274 LKTVFLSCLKCTHPAA 289
                    **********322223 PP

  == domain 2  score: -0.2 bits;  conditional E-value: 0.037
        DUF3453  116 kvlqeasiltsslviatlnslasiakqRpqfankilqallsfnplkk 162 
                     +++ + +  t++++ ++ln+l++ +     f+ ++lqa+  f +l+ 
  VIMSS10104004 1112 TCFAQRQTFTQQVLAGVLNQLVQQIPLPMLFMRTVLQAIGAFPALSD 1158
                     56778888999999999999999999999999999999999998766 PP



Or compare VIMSS10104004 to CDD or PaperBLAST