PaperBLAST – Find papers about a protein or its homologs

 

Align NP_055070.1 to PF11938 (DUF3456)

NP_055070.1 has 182 amino acids

Query:       DUF3456  [M=156]
Accession:   PF11938.8
Description: TLR4 regulator and MIR-interacting MSAP
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    2.3e-46  144.3   0.5    2.9e-46  144.0   0.5    1.1  1  NP_055070.1  


Domain annotation for each sequence (and alignments):
>> NP_055070.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  144.0   0.5   2.9e-46   2.9e-46       1     156 []      27     171 ..      27     171 .. 0.91

  Alignments for each domain:
  == domain 1  score: 144.0 bits;  conditional E-value: 2.9e-46
      DUF3456   1 kCeaCkalveeleealseedpkkevdvgsfrldskgkkkkkkipyakSElrltevleevCekmldYalhkekktskrvykkmsedlkelkelkdkevk 98 
                  +C+aC+alv+ele++++++dpkk++++gsfr++++g+++  ++pya+SE++lte+lee+C++m++Y+++ +++t+++ y++++    e +el  ++++
  NP_055070.1  27 HCGACRALVDELEWEIAQVDPKKTIQMGSFRINPDGSQSVVEVPYARSEAHLTELLEEICDRMKEYGEQIDPSTHRKNYVRVVGRNGESSELDLQGIR 124
                  6********************************************************************************98855555555555565 PP

      DUF3456  99 vdlgipselkdepaevkelkkaCeelveeyEdeleelfkeeeeedleekLCeerskeC 156
                   d++             +lk+aCe++veeyEdel+e+f++ e++++++kLC++r++ C
  NP_055070.1 125 IDSD----------ISGTLKFACESIVEEYEDELIEFFSR-EADNVKDKLCSKRTDLC 171
                  3333..........3699**********************.8**************99 PP



Or compare NP_055070.1 to CDD or PaperBLAST