PaperBLAST – Find papers about a protein or its homologs

 

Align SwissProt::A3KNS2 to PF11938 (DUF3456)

SwissProt::A3KNS2 has 276 amino acids

Query:       DUF3456  [M=156]
Accession:   PF11938.8
Description: TLR4 regulator and MIR-interacting MSAP
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence          Description
    ------- ------ -----    ------- ------ -----   ---- --  --------          -----------
    5.8e-50  156.0   3.1    5.8e-50  156.0   3.1    2.4  3  SwissProt::A3KNS2  


Domain annotation for each sequence (and alignments):
>> SwissProt::A3KNS2  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  156.0   3.1   5.8e-50   5.8e-50       1     152 [.      31     181 ..      31     190 .. 0.96
   2 ?   -3.7   6.0      0.87      0.87      19      47 ..     208     236 ..     201     247 .. 0.48
   3 ?   -0.8   1.1      0.11      0.11      13      50 ..     238     274 ..     231     276 .] 0.67

  Alignments for each domain:
  == domain 1  score: 156.0 bits;  conditional E-value: 5.8e-50
            DUF3456   1 kCeaCkalveeleealseedpkkevdvgsfrldskgkkkkkk.ipyakSElrltevleevCekmldYalhkekktskrvykkmsedlkelke 91 
                        kCe+Ck++  e+++a++e++++kev  +++r+    ++k+   i+y kS++r++ev e+vC+++ +Y+lhke+++s+r++k+mse++++l++
  SwissProt::A3KNS2  31 KCEVCKFVSIEMKSAFDETGKTKEVIDTNYRFL---DDKGAPpIKYVKSDIRFIEVTENVCSRIMQYNLHKERDGSNRFAKGMSETFSTLHN 119
                        8******************************96...8888888************************************************* PP

            DUF3456  92 lkdkevkvdlgipselkdep.aevkelkkaCeelveeyEdeleelfkeeeeedleekLCeer 152
                        l++k+vkv ++ip+el++e+ aev +lkk+C+ +ve+yEd +e+++k ++eedl+++LCe++
  SwissProt::A3KNS2 120 LVNKGVKVVMDIPYELWNETsAEVADLKKQCDVMVEQYEDVIEDWYKGSQEEDLTTYLCEKH 181
                        *******************99***************************9***********98 PP

  == domain 2  score: -3.7 bits;  conditional E-value: 0.87
            DUF3456  19 edpkkevdvgsfrldskgkkkkkkipyak 47 
                         ++kk+ + ++ +  ++g+kk+kk++ +k
  SwissProt::A3KNS2 208 DKKKKKGKKKKGKDGEDGQKKEKKVKKKK 236
                        44444433333333345666666643333 PP

  == domain 3  score: -0.8 bits;  conditional E-value: 0.11
            DUF3456  13 eealseedpkkevdvgsfrldskgkkkkkkipyakSEl 50 
                        ++++s+++++k  ++    + s++++ +kk+p++++++
  SwissProt::A3KNS2 238 KSKISDSESSKR-RMEAAGFTSDEEEIQKKVPLNQPKT 274
                        456666666666.5555567777888888888877665 PP



Or compare SwissProt::A3KNS2 to CDD or PaperBLAST