PaperBLAST – Find papers about a protein or its homologs

 

Align SwissProt::Q2L6K8 to PF11938 (DUF3456)

SwissProt::Q2L6K8 has 217 amino acids

Query:       DUF3456  [M=156]
Accession:   PF11938.8
Description: TLR4 regulator and MIR-interacting MSAP
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence          Description
    ------- ------ -----    ------- ------ -----   ---- --  --------          -----------
      2e-52  164.0   6.6    2.5e-52  163.7   6.6    1.1  1  SwissProt::Q2L6K8  


Domain annotation for each sequence (and alignments):
>> SwissProt::Q2L6K8  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  163.7   6.6   2.5e-52   2.5e-52       1     156 []      26     185 ..      26     185 .. 0.96

  Alignments for each domain:
  == domain 1  score: 163.7 bits;  conditional E-value: 2.5e-52
            DUF3456   1 kCeaCkalveeleealseedpkkevdvgsfrldskgkkkkkkipyakSElrltevleevCekmldYalhkekktskrvykkmsedlkelkel 92 
                        kCe+Ck+l+ el++al++++++kev + +  ld    k+++ki+y++SE+rlte+++++Ce++l+Y++h+e+++s r++k++s+++++lk+l
  SwissProt::Q2L6K8  26 KCEVCKLLTVELQDALDKTGRSKEVVELGEVLD--TGKRRRKIKYNTSEMRLTEAMDNICERILQYKVHAERPGSLRYAKGTSQTMNTLKNL 115
                        8*******************************9..5566667************************************************** PP

            DUF3456  93 kdkevkvdlgipselkdep.aevkelkkaCeelveeyEdeleelfkeeeeedleekLCeer.....skeC 156
                        ++k+vkv+lg+p+el+dep +ev elk +Ce+++ee+E+ +e+++++++++ le+++Ce +     ++eC
  SwissProt::Q2L6K8 116 VEKGVKVELGVPYELWDEPtVEVAELKRQCETMLEEHEEVVEDWYFHHQDKGLERFFCEAHvlkdsDQEC 185
                        ******************99***************************************99887777777 PP



Or compare SwissProt::Q2L6K8 to CDD or PaperBLAST