PaperBLAST – Find papers about a protein or its homologs

 

Align SwissProt::Q9DAU1 to PF11938 (DUF3456)

SwissProt::Q9DAU1 has 276 amino acids

Query:       DUF3456  [M=156]
Accession:   PF11938.8
Description: TLR4 regulator and MIR-interacting MSAP
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence          Description
    ------- ------ -----    ------- ------ -----   ---- --  --------          -----------
      8e-51  158.8   3.3    1.1e-50  158.3   3.3    1.2  1  SwissProt::Q9DAU1  


Domain annotation for each sequence (and alignments):
>> SwissProt::Q9DAU1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  158.3   3.3   1.1e-50   1.1e-50       1     153 [.      48     203 ..      48     206 .. 0.96

  Alignments for each domain:
  == domain 1  score: 158.3 bits;  conditional E-value: 1.1e-50
            DUF3456   1 kCeaCkalveeleealseedpkkevdvgsfrldskgkkkkkkipyakSElrltevleevCekmldYalhkekktskrvykkmsedlkelkel 92 
                        kCe+Ck+++ el++a++e++++kev  +++ +    + k++ ++y+kS+lrl+ev e++C+++ldY+lhke+++s+r++k+mse++++l++l
  SwissProt::Q9DAU1  48 KCEVCKYVAVELKSAFEETGKTKEVIDTGYGIL---DGKGSGVKYTKSDLRLIEVTETICKRLLDYSLHKERTGSNRFAKGMSETFETLHNL 136
                        8*******************************6...899999************************************************** PP

            DUF3456  93 kdkevkvdlgipselkdep.aevkelkkaCeelveeyEdeleelfkeeeeedleekLCeer.....s 153
                        ++k+vkv ++ip+el++e+ aev +lkk+C+ lvee+E+ +e+++++++eedl+e+LC ++     +
  SwissProt::Q9DAU1 137 VHKGVKVVMDIPYELWNETsAEVADLKKQCDVLVEEFEEVIEDWYRNHQEEDLTEFLCANHvlkgkD 203
                        ******************99***************************************98555544 PP



Or compare SwissProt::Q9DAU1 to CDD or PaperBLAST