PaperBLAST – Find papers about a protein or its homologs

 

Align XP_006513965.1 to PF11938 (DUF3456)

XP_006513965.1 has 182 amino acids

Query:       DUF3456  [M=156]
Accession:   PF11938.8
Description: TLR4 regulator and MIR-interacting MSAP
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
    1.4e-46  145.1   0.8    1.7e-46  144.8   0.8    1.1  1  XP_006513965.1  


Domain annotation for each sequence (and alignments):
>> XP_006513965.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  144.8   0.8   1.7e-46   1.7e-46       1     156 []      27     171 ..      27     171 .. 0.92

  Alignments for each domain:
  == domain 1  score: 144.8 bits;  conditional E-value: 1.7e-46
         DUF3456   1 kCeaCkalveeleealseedpkkevdvgsfrldskgkkkkkkipyakSElrltevleevCekmldYalhkekktskrvykkmsedlkelkelkdk 95 
                     +C+aC+alv+ele++++++dpkk++++gsfr++++g+++  ++pya+SE++lte+leevC++m++Y+++ +++t+++ y+++++   e +el  +
  XP_006513965.1  27 HCGACRALVDELEWEIARVDPKKTIQMGSFRINPDGSQSVVEVPYARSEAHLTELLEEVCDRMKEYGEQIDPSTHRKNYVRVVSRNGESSELDLQ 121
                     6*********************************************************************************9855555555556 PP

         DUF3456  96 evkvdlgipselkdepaevkelkkaCeelveeyEdeleelfkeeeeedleekLCeerskeC 156
                     +++ d++             +lk+aCe++veeyEdel+e+f++ e++++++kLC++r++ C
  XP_006513965.1 122 GIRIDSD----------ISGTLKFACESIVEEYEDELIEFFSR-EADNVKDKLCSKRTDLC 171
                     6663333..........3699**********************.8**************99 PP



Or compare XP_006513965.1 to CDD or PaperBLAST