biolip::7ddbA has 223 amino acids
Query: Ice_binding [M=208] Accession: PF11999.12 Description: Ice-binding-like Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.2e-65 204.8 20.6 7.1e-65 204.6 20.6 1.0 1 biolip::7ddbA Domain annotation for each sequence (and alignments): >> biolip::7ddbA # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 204.6 20.6 7.1e-65 7.1e-65 1 207 [. 16 220 .. 16 221 .. 0.98 Alignments for each domain: == domain 1 score: 204.6 bits; conditional E-value: 7.1e-65 Ice_binding 1 ilaksgitntGttvitGdiGvspaaataitGfal.l.asg.estsglvltGkvyaadaaaatpatltqAvadletAyndaagrttpaltelgagel 93 ila+ +++++++++itG +G+spaa t +tGf+l + +g +sts++v tG++ aad+ ++tp++lt+A+ d+ tAy++ a+r+ p++ e+++g l biolip::7ddbA 16 ILASYAVSTVPQSAITGAVGISPAAGTFLTGFSLtMsGTGtFSTSTQV-TGQLTAADYGTPTPSILTTAIGDMGTAYTNGATRSGPDFLEIYTGAL 110 799*******************************7777778*******.8********************************************** PP Ice_binding 94 ggltltpGvYkstssvtistgdltLDaqgdanavwiFqiastLttasgssvvLinGAqaknvfWqVggsatlgtgstfeGnilaqtsitlntgatv 189 gg+tl pG+Yk+tssv ++d t+ +g ++++wiFqi++tL a+g++++L++GAqakn++W+V+g++++ +g++feG+ila+t++tl+tg+++ biolip::7ddbA 111 GGTTLLPGLYKWTSSVGA-SADFTI--SGTSTDTWIFQIDGTLGLAAGKKITLAGGAQAKNIIWVVAGAVSIEAGAQFEGVILAKTAVTLKTGSSL 203 ******************.66****..********************************************************************* PP Ice_binding 190 nGrllaqtgaVtLdnnti 207 nGr+laqt +V+L+++t+ biolip::7ddbA 204 NGRILAQT-SVALQSATV 220 ********.9*****998 PP
Or compare biolip::7ddbA to CDD or PaperBLAST