PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS10091869 to PF12036 (DUF3522)

VIMSS10091869 has 807 amino acids

Query:       DUF3522  [M=188]
Accession:   PF12036.8
Description: Protein of unknown function (DUF3522)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence      Description
    ------- ------ -----    ------- ------ -----   ---- --  --------      -----------
    7.9e-59  185.2  12.5    1.4e-58  184.4  12.5    1.5  1  VIMSS10091869  


Domain annotation for each sequence (and alignments):
>> VIMSS10091869  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  184.4  12.5   1.4e-58   1.4e-58       1     188 []     560     766 ..     560     766 .. 0.98

  Alignments for each domain:
  == domain 1  score: 184.4 bits;  conditional E-value: 1.4e-58
        DUF3522   1 eqllqlllltlSnlaflpaiyvalkrryvfeavvytftmlfStlYHacdspgtfclekydvlqlsdfilsilavwvtlvyladldeklksllhylg 96 
                    e+++q++ l++Sn+a+l+++y+al++r + e+v++t+++++S+lYHacd +gt+c+++y+vlq++df+ls++av+ t+vyl++  e++k+++h+++
  VIMSS10091869 560 EHIVQSIALIASNAAALLPAYWALRQREYPEWVLFTSSGISSALYHACD-VGTWCVLSYNVLQFMDFWLSFMAVVGTFVYLSTAGEAVKRTIHTVV 654
                    699**********************************************.5********************************************* PP

        DUF3522  97 lllvailqekdrwslantiipilvgllillvswliecvkkrklypsllr.....................rrlkrlnlqqllpgllllalAlfllg 171
                    ++l+a+l+ +++++++n+ii++++g l ll+++l+e+v+k+++y+ +                       + +kr+++ ++++gl+++++A+++++
  VIMSS10091869 655 AILTALLALTQATRASNIIIVLAIGSLGLLIGFLVEFVTKYRSYCGSAGfslnmldrpravkewfsnlikTLKKRFRWGFVAAGLVAFTMAAISFK 750
                    **********************************************777*********************************************** PP

        DUF3522 172 ldetednyrivHslWHi 188
                     +et+++y+++Hs+WH+
  VIMSS10091869 751 -VETSSSYWMWHSIWHF 766
                    .9**************6 PP



Or compare VIMSS10091869 to CDD or PaperBLAST