PaperBLAST – Find papers about a protein or its homologs

 

Align XP_016870295.1 to PF12036 (DUF3522)

XP_016870295.1 has 482 amino acids

Query:       DUF3522  [M=188]
Accession:   PF12036.8
Description: Protein of unknown function (DUF3522)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
    1.7e-49  154.8  11.7    2.6e-49  154.2  11.7    1.3  1  XP_016870295.1  


Domain annotation for each sequence (and alignments):
>> XP_016870295.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  154.2  11.7   2.6e-49   2.6e-49       2     135 ..     232     367 ..     231     417 .. 0.87

  Alignments for each domain:
  == domain 1  score: 154.2 bits;  conditional E-value: 2.6e-49
         DUF3522   2 qllqlllltlSnlaflpaiyvalkrryvfeavvytftmlfStlYHacdspg..tfclekydvlqlsdfilsilavwvtlvyladldeklksllhy 94 
                     qll++lll+lSnl+flp++++a++ ryv ea+vytftm+fSt+YHacd+pg  +fc+++ydvlq++df++s+++vwvt++++a+l++++k++l +
  XP_016870295.1 232 QLLSTLLLCLSNLMFLPPVVLAIRSRYVLEAAVYTFTMFFSTFYHACDQPGivVFCIMDYDVLQFCDFLGSLMSVWVTVIAMARLQPVVKQVLYL 326
                     6899******************************************************************************************* PP

         DUF3522  95 lglllvailqekdrwslantiipilvgllillvswliecvk 135
                     lg++l+ ++ ++dr++l+n+++p l++l il+++w+     
  XP_016870295.1 327 LGAMLLSMALQLDRHGLWNLLGPSLFALGILATAWYAASAA 367
                     ***********************************333322 PP



Or compare XP_016870295.1 to CDD or PaperBLAST