PaperBLAST – Find papers about a protein or its homologs

 

Align CharProtDB::CH_123802 to PF12051 (DUF3533)

CharProtDB::CH_123802 has 609 amino acids

Query:       DUF3533  [M=378]
Accession:   PF12051.8
Description: Protein of unknown function (DUF3533)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence              Description
    ------- ------ -----    ------- ------ -----   ---- --  --------              -----------
   1.5e-108  349.2  25.6     2e-108  348.7  25.6    1.2  1  CharProtDB::CH_123802  


Domain annotation for each sequence (and alignments):
>> CharProtDB::CH_123802  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  348.7  25.6    2e-108    2e-108       1     377 [.     181     570 ..     181     571 .. 0.98

  Alignments for each domain:
  == domain 1  score: 348.7 bits;  conditional E-value: 2e-108
                DUF3533   1 nvlllavlilailslywGalyrrsdrlknlnvlvVneDeggseltpvvgeavaqainettss.slgtwtvvnpsefke........se 79 
                            n++ l++ + a+l++y G++y+r++r+knl++++ + D ++++l ++vg++++ +++++++   lg++++++ ++ ++         +
  CharProtDB::CH_123802 181 NYVYLVLGFAAVLCIYTGSYYNRTSRFKNLKMAIMIGDRNSTQLPNIVGQTIEGYFTKVPALqALGNFDIWDYDRLSNlaashnntLT 268
                            7899********************************************************9999********999999*******99* PP

                DUF3533  80 eeveelvhkekywgaivvkenateklyaalsangassynst.elleliyesgRdattvssyilpaltqleaaalakygsqllq.qliq 165
                            eev++++h++kyw+a++v enat ++y+al a+g++++n+t +l+e++ye+gRd+++v+ yi++++ q+ + + + + ++ l  ++++
  CharProtDB::CH_123802 269 EEVYRQIHHQKYWAAFYVYENATLNWYQAL-ASGSKTFNPTnSLMEVVYETGRDYNAVNNYIVTIIGQILRGYYKFIPQSGLVvNMLK 355
                            ******************************.**********999*******************************777776666**** PP

                DUF3533 166 slsntaqaaqlsna..llaspiafnsidlrPftdgvalaplqvgliyliiltffqfaflgklhaemglsrklkfkqllvyrllisvvs 251
                            +l++t+++++++na  l+++  +f++ dl+P++++v  a +q+  +yli+ltff f+f +++++++  ++k+k  +++++r+++++v+
  CharProtDB::CH_123802 356 TLNSTQANNVINNApqLISTIPTFSIHDLHPVPNPVFSATMQLAGVYLIVLTFFAFVFSIQIQMYI--ASKVKGIKYVIFRMMSNQVA 441
                            ***********999*************************************************999..9******************* PP

                DUF3533 252 lfvlSlffslvslafqvdftvafGragFvvyWmitwlvmaavglanenvasil...gppylpvwllfwvilNvsstfvPlelspgFYr 336
                            +f++Sl f+++++af+++f+ +fG+agF+v+W++++l m+a+g ++e +++i+   +pp+++++llf v+lN+++t+ P+ l+p+FYr
  CharProtDB::CH_123802 442 YFIISLAFVVLNTAFGLPFNGTFGHAGFLVIWVFSYLLMSAIGSVIEFFVLIVfalKPPMIGFVLLFTVVLNLAPTISPIILCPKFYR 529
                            **************************************************9999********************************** PP

                DUF3533 337 ygyalPlhniveilrvIffdtakgqlgrnlgiLlawvvvnt 377
                            ygya+Pl n +++l+v +f+++kg +grn+giL+aw+vv++
  CharProtDB::CH_123802 530 YGYAMPLKNFYDLLQVAYFNAWKGHMGRNIGILFAWMVVSN 570
                            **************************************986 PP



Or compare CharProtDB::CH_123802 to CDD or PaperBLAST