PaperBLAST – Find papers about a protein or its homologs

 

Align NP_011713.1 to PF12051 (DUF3533)

NP_011713.1 has 547 amino acids

Query:       DUF3533  [M=378]
Accession:   PF12051.8
Description: Protein of unknown function (DUF3533)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
   5.2e-132  426.3  14.9   6.5e-132  426.0  14.9    1.1  1  NP_011713.1  


Domain annotation for each sequence (and alignments):
>> NP_011713.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  426.0  14.9  6.5e-132  6.5e-132       1     377 [.     112     497 ..     112     498 .. 0.98

  Alignments for each domain:
  == domain 1  score: 426.0 bits;  conditional E-value: 6.5e-132
      DUF3533   1 nvlllavlilailslywGalyrrsdrlknlnvlvVneDeggseltpvvgeavaqainettssslgtwtvvnpsefke.........seeeveelvhke 89 
                  n +++a+++++++s+ywGa y +++++ +++ +vV +D  +++ ++ +  ++ +++ +++    gtw+++n ++f+          ++ ++ +l+++e
  NP_011713.1 112 NNFFIACVCVSLISIYWGACYGTDRYFFKVKNIVVLQDAPSNTSVQSISAIIPSLLASVP----GTWHIYNATSFHRkfgttnsteIDRKIVDLIYDE 205
                  6799************************************9999999************9....99*********99********************* PP

      DUF3533  90 kywgaivvkenateklyaal.sangassynstelleliyesgRdattvssyilpaltqleaaalakygsqllqqliqslsntaqaaqlsna..llasp 184
                  +yw+a++vk+nat++ly++l s++ +s++ns+  +e+++esgRd+++v+s ilp ++qle  ++++y++++l++l++++++ +++ +++ +  ++a +
  NP_011713.1 206 RYWLALNVKPNATDTLYNSLiSQDANSEFNSSIFFESVFESGRDPSSVKSTILPLMQQLEVRLQKYYVKEYLPSLMSNITSNDRDLNINMEnwAIAGQ 303
                  ********************************************************************************9999999877789***** PP

      DUF3533 185 iafnsidlrPftdgvalaplqvgliyliiltffqfaflgklhaemglsrklkfkqllvyrllisvvslfvlSlffslvslafqvdftvafGragFvvy 282
                  + f+++d+rPf d++++aplqvgliy+i+lt+ q++++gklh em  +r lk+k++l+yrllis+ ++f lS+ f++vs++f++dft afGr+gFvvy
  NP_011713.1 304 LLFTYNDYRPFADRILMAPLQVGLIYCILLTVLQLSLYGKLHGEM--ARVLKPKHILIYRLLISWATYFLLSIGFCTVSAIFRIDFTPAFGRGGFVVY 399
                  *********************************************..9************************************************** PP

      DUF3533 283 Wmitwlvmaavglanenvasil...gppylpvwllfwvilNvsstfvPlelspgFYrygyalPlhniveilrvIffdtakgqlgrnlgiLlawvvvnt 377
                  Wm+twlvm+avg+anenv+s++   +ppyl++wl++w+ilN+s +f+P++l+++FYrygy +P+hn+v+i++vIf+++ k ++grn+giL+awv++nt
  NP_011713.1 400 WMSTWLVMMAVGGANENVLSLViayCPPYLSIWLMTWIILNISASFYPMVLNNEFYRYGYIMPIHNAVDIYKVIFLNLTKRKMGRNYGILVAWVALNT 497
                  ***********************************************************************************************997 PP



Or compare NP_011713.1 to CDD or PaperBLAST