PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS31951 to PF12051 (DUF3533)

VIMSS31951 has 452 amino acids

Query:       DUF3533  [M=378]
Accession:   PF12051.8
Description: Protein of unknown function (DUF3533)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence   Description
    ------- ------ -----    ------- ------ -----   ---- --  --------   -----------
    2.9e-50  157.3   0.2    3.5e-50  157.0   0.2    1.1  1  VIMSS31951  


Domain annotation for each sequence (and alignments):
>> VIMSS31951  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  157.0   0.2   3.5e-50   3.5e-50       5     376 ..      32     403 ..      28     405 .. 0.88

  Alignments for each domain:
  == domain 1  score: 157.0 bits;  conditional E-value: 3.5e-50
     DUF3533   5 lavlilails.lywGalyrrsdrlknlnvlvVneDeggseltpvvgeavaqainettssslgtwtvvnpsefkeseeeveelvhkekywgaivvkenat 102
                 +++  +++l+ ly G+++++ ++l+++++++VneD g     p+ +++v+ +++ +  +++ +++vv       s++e ++l+++  ++g+  +++ ++
  VIMSS31951  32 TTLALMSALAaLYLGGILNPMTNLRHFPIALVNEDAG-----PAGQQIVDGLVSGLD-KNKFDIRVV-------SPDEARRLLDTAAVYGSALIPPTFS 117
                 55666777766**************************.....888888888888888.578888888.......699********************** PP

     DUF3533 103 eklyaalsangassynstelleliyesgRdattvssyilpaltqleaaalakygsqllqqliqslsntaqaaqlsnallaspiafnsidlrPftdgval 201
                 ++l++   a+  +++++ + + +i +++R  t  +s+  ++lt   ++++ k+g++l+ ++++++   a a   + a laspi+++s  ++P+++g++ 
  VIMSS31951 118 SQLRDFG-ASAVTPTRTDRPAITISTNPRAGTLAASIAGQTLTRALTVVNGKVGERLTAEVAAQTGGVALAGA-AAAGLASPIDVKSTAYNPLPNGTGN 214
                 ******9.8888899999***********7555556666777777777777*************998777776.4458********************* PP

     DUF3533 202 aplqvgliyliiltffq.........faflgklhaemg......lsrkl.kfkqllvyrllisvvslfvlSlffslvslafqvdftvafGragFvvyWm 284
                 +++++++++l++l++f+         +++lg++ ae+g       + ++ +f++ l+++++++vv+++  S ++ ++   +++++++ +       +W+
  VIMSS31951 215 GLSAFYYALLLLLAGFTgsivvstlvDSMLGYVPAEFGpvyrfaEQVNIsRFRT-LLVKWAVMVVLALLTSGVYLAIAHGLGMPIPLGW------QVWL 306
                 **************************************9887443334434444.666***************************4443......56** PP

     DUF3533 285 itwlvmaavglanenvasilgppylpvwllfwvilNvss..tfvPlelspgFYrygyal.PlhniveilrvI.ffdtak.gqlgrnlgiLlawvvvn 376
                 + +++++avg++  +++++lg  +l+v +l++vil ++s  ++vPle+ p+F+r+++++ P+h+++ ++r+  ++++ + + l ++l+++ + ++++
  VIMSS31951 307 YGVFAIIAVGVTSSSLIAVLGSMGLLVSMLIFVILGLPSagATVPLEAVPAFFRWLAQFePMHQVFLGVRSLlYLNGNAdAGLSQALTMTSIGLIIG 403
                 ***************************************999******************************8777777699999999988877765 PP



Or compare VIMSS31951 to CDD or PaperBLAST