PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS37549 to PF12051 (DUF3533)

VIMSS37549 has 775 amino acids

Query:       DUF3533  [M=378]
Accession:   PF12051.8
Description: Protein of unknown function (DUF3533)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence   Description
    ------- ------ -----    ------- ------ -----   ---- --  --------   -----------
    1.4e-20   59.5  15.3    3.7e-13   35.2   0.0    3.2  3  VIMSS37549  


Domain annotation for each sequence (and alignments):
>> VIMSS37549  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   35.2   0.0   3.7e-13   3.7e-13       3     174 ..      21     180 ..      18     198 .. 0.78
   2 !    2.5   0.7    0.0031    0.0031      46     164 ..     361     493 ..     332     500 .. 0.71
   3 !   26.2   6.4   1.9e-10   1.9e-10     233     377 ..     611     752 ..     541     753 .. 0.76

  Alignments for each domain:
  == domain 1  score: 35.2 bits;  conditional E-value: 3.7e-13
     DUF3533   3 lllavlilails.lywGalyrrsdrlknlnvlvVneDeg..gseltpvvgeavaqainettssslgtwtvvnpsefkeseeeveelvhkekywgaivvk 98 
                 ++  +++  i s ++  a+ ++   + +l+v+vVn+D+g  +++++  +g+ + + +++++     +w++ n      + ++  +++ ++ky++++ ++
  VIMSS37549  21 IIAILFVPLIYSgVFLKAYWDPYGTVDQLPVVVVNQDKGatYEGEKLQIGDDLVKELKDNN---NFDWHFSN------DLDQSLKDLLNQKYYLVVEIP 110
                 555566666666688889999999***************9966666566665555555555...48999887......8899999999*********** PP

     DUF3533  99 enateklyaalsangassynstelleliyesgRdattvssyi.lpaltqleaaalakygsqllqqliqslsntaqaa 174
                 e+++++ ++ l++n +        l+l y ++   + v + i  +a+++l+a + +++++q+++ +  +++++a+  
  VIMSS37549 111 EDFSKNASTVLDKNPK-------KLDLKYHTNAGSNYVGATIgEKAIDKLKASVSKEVTEQYTKVIFDNFKDIAKGL 180
                 ***********33333.......46666777766677777773678999******************9999988755 PP

  == domain 2  score: 2.5 bits;  conditional E-value: 0.0031
     DUF3533  46 pvvgeavaqainettssslgtwtvvnpsefke............seeeveelvhkekywga.ivvkenateklyaalsangassynstelleliyesgR 131
                 +     +a++ +++++s   ++ +v+  +f++            + + +++ + + k+  a +   ++at+kly+ +++ +++  + te ++ iy+ ++
  VIMSS37549 361 NSSDFLTAEQKSQLINSVEKKLPQVDAPDFDQilsqlptadqlpDIATIKSSLEDVKAQVAqVKAMPEATSKLYNGAKTIQDAIDRLTEGADKIYNGSQ 459
                 4444444444555554433334444444454455566668888888888888888888777477899**********788887888889********** PP

     DUF3533 132 dattvssyilpaltqleaaala.kygsqllqqli 164
                 + t  ++ ++  + + ++++++ k gs+ l +  
  VIMSS37549 460 KLTDGQTKLTAGIGEYNKQFAKaKAGSEQLVTGS 493
                 *****************99998777776665554 PP

  == domain 3  score: 26.2 bits;  conditional E-value: 1.9e-10
     DUF3533 233 rklkfkqllvyrllisvvslfvlSlffslvslafqvdftvafGragFvvyWmitwlvmaavglanenvasilgppylpvwllfwvi.lNvsstfvPlel 330
                 r+ +  ++++ ++ +++++ ++ Sl++ +v  ++++  +v+     F v+ +it+l+++    +++ +a+ +g+p+  ++ +++v  l  s +++Plel
  VIMSS37549 611 RPRNGFEWFFSKFNVMMLVGIIQSLIVATVL-LLGIGLEVESTW-RFYVFTIITSLAFL---AIIQFLATTMGNPGRFIAVIILVLqLGASGGTFPLEL 704
                 5556678999999999999999999998885.455555444333.45655555555555...556667777877777766666666255566******* PP

     DUF3533 331 spgFYrygyal.PlhniveilrvIffdtakgqlgrnlgiLlawvvvnt 377
                  p+FY+  +   P+ +++++ r++++++  g + + +g+L++  +v++
  VIMSS37549 705 LPNFYQVIHGAlPMTYSINGFRAVISNGDFGYMWQMAGVLIGIALVMI 752
                 ******998666*****************************9998876 PP



Or compare VIMSS37549 to CDD or PaperBLAST