PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS4040477 to PF12051 (DUF3533)

VIMSS4040477 has 896 amino acids

Query:       DUF3533  [M=378]
Accession:   PF12051.8
Description: Protein of unknown function (DUF3533)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence     Description
    ------- ------ -----    ------- ------ -----   ---- --  --------     -----------
    5.8e-12   31.2  25.2    2.8e-11   29.0   0.1    3.4  3  VIMSS4040477  


Domain annotation for each sequence (and alignments):
>> VIMSS4040477  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   29.0   0.1   2.8e-11   2.8e-11       6     165 ..      25     183 ..      20     206 .. 0.66
   2 !    1.0   2.9    0.0088    0.0088     102     179 ..     368     444 ..     356     462 .. 0.84
   3 !    9.3   9.8   2.6e-05   2.6e-05     160     375 ..     659     866 ..     636     869 .. 0.80

  Alignments for each domain:
  == domain 1  score: 29.0 bits;  conditional E-value: 2.8e-11
       DUF3533   6 avlilailsly....wGalyrrsdrlknlnvlvVneDeg.......gseltpvvgeavaqainettssslgtwtvvnpsefkeseeeveelvhkeky 91 
                   ++  + + sly    + al ++ ++++ ++v+v + Deg       ++ ++ +vg+++++ +++++   +  wt+v       se+e ++ v  +ky
  VIMSS4040477  25 VIALIILPSLYawfnIEALWDPYSNTSGIKVAVSIDDEGaeidvpgKKPQQVNVGNQLKKTLEKNK---KLGWTFV-------SEDEAKKGVKSGKY 111
                   444444444553333457888889999999999999999777655444455555555555555555...4569999.......69************ PP

       DUF3533  92 wgaivvkenateklyaal.sangassynstelleliyesgRdattvssyilpaltqleaaalakygsqllqqliq 165
                   +++i+++++++e++++ + ++ ++++ + + + e i  ++  ++  +s  +++++q++++++ ++++ +l+++++
  VIMSS4040477 112 YASIHIPKDFSEDMVSVVnDNVTKPTIDYS-VNEKI--NAIAPKMTESGATTIVNQISSEFVGTVSKAVLEEFNK 183
                   ******************444455444444.22222..2223345566666666666666666666666655554 PP

  == domain 2  score: 1.0 bits;  conditional E-value: 0.0088
       DUF3533 102 teklyaalsangassynstelleliyesgRdattvssyilpaltqleaaalakygsqllqqliqslsntaqaaqlsna 179
                    +++y+ ++a ++ s  ++++++   +  +d  +++++i++++ +le+ ++ ++ ++ +++li++l++++    ++++
  VIMSS4040477 368 ADNIYQVTEAIKNGSITPEQAITELKKMEQDIDSLQQMITKQTATLESLNE-TLPNKPFTDLIANLKTINSQLGAQKE 444
                   57888888888888999999999999****************999998776.69999999****99999888776555 PP

  == domain 3  score: 9.3 bits;  conditional E-value: 2.6e-05
       DUF3533 160 lqqliqslsntaqaaqlsnallaspiafnsidlrPftdgvalaplqvgliyliiltffqfaflgklhaemglsrklkfkqllvyrllisvvslfvlS 256
                   lq++i+ l n a+++++    +asp++++   + P+++  + a++ ++ ++++ +    +  l  +  e+  +  ++  +  + rll  ++  ++ +
  VIMSS4040477 659 LQSIIKMLRNDADKDSS---FIASPVKLKETSYYPIPNY-GSASSPFYTALCLWVGALLLISLLRVDVEVP-AGIFSHYHRYFGRLLTFLSIGLMQA 750
                   56778888887777775...999************9875.5566689******999999999999999992.4444666667889999999999999 PP

       DUF3533 257 lffslvs.lafqvdftvafGragFvvyWmitwlvmaavglanenvasilgppylpvwllfwvi.lNvsstfvPlelspgFYrygyal.Plhniveil 350
                   l+++l +  +++v +      a++++  ++++++ +++  +  +++s++ + + +++++++v  +  + + +P+++sp F++  y + P+ ++v ++
  VIMSS4040477 751 LIVTLGNiFLLGVSI------AEPLLHVLFSMFISVVFMTIVYTLVSLFNNVGKGIAIILLVLqISGAGGNFPIQVSPPFFQAIYPFlPFTYAVSLI 841
                   999887757899999......999999888888888888888999999988888888777765234455**************************** PP

       DUF3533 351 rvIffdtakgqlgrnlgiLlawvvv 375
                   r    +++ ++   ++ +L+++ ++
  VIMSS4040477 842 RESVGGLYMPTVWIDMSVLAGFAIL 866
                   *998888888888888888887665 PP



Or compare VIMSS4040477 to CDD or PaperBLAST